SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20069
         (636 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)...   135   2e-32
At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)...   135   2e-32
At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)...   135   2e-32
At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)...   132   2e-31
At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70...   131   3e-31
At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS...   130   6e-31
At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS...   130   6e-31
At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta...   130   6e-31
At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS...   129   2e-30
At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70...   128   2e-30
At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, p...    92   3e-19
At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70...    88   4e-18
At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)...    87   9e-18
At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)...    85   5e-17
At1g79930.1 68414.m09340 heat shock protein, putative contains P...    64   7e-11
At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70...    64   7e-11
At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70...    64   7e-11
At1g11660.1 68414.m01339 heat shock protein, putative strong sim...    57   9e-09
At2g32120.2 68415.m03926 heat shock protein 70 family protein / ...    41   6e-04
At2g32120.1 68415.m03925 heat shock protein 70 family protein / ...    41   6e-04
At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70...    38   0.007
At1g22190.1 68414.m02775 AP2 domain-containing transcription fac...    31   0.64 
At5g23520.1 68418.m02760 expressed protein                             29   3.4  
At5g01550.1 68418.m00070 lectin protein kinase, putative similar...    28   6.0  

>At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 613

 Score =  135 bits (327), Expect = 2e-32
 Identities = 64/86 (74%), Positives = 73/86 (84%)
 Frame = +2

Query: 251 EEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAA 430
           +E+   +G+VIGIDLGTTYSCVGVYKNG VEIIANDQGNRITPS+V FT D ERLIG+AA
Sbjct: 28  KEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFT-DSERLIGEAA 86

Query: 431 KNQLTTNPENTVFDAKRLIGREWSDQ 508
           KNQ   NPE TVFD KRLIGR++ D+
Sbjct: 87  KNQAAVNPERTVFDVKRLIGRKFEDK 112



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D K  P+++V K+ KP++QV+   G+ KVF+PEEISAM+L
Sbjct: 114 VQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL 156


>At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 668

 Score =  135 bits (327), Expect = 2e-32
 Identities = 64/86 (74%), Positives = 73/86 (84%)
 Frame = +2

Query: 251 EEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAA 430
           +E+   +G+VIGIDLGTTYSCVGVYKNG VEIIANDQGNRITPS+V FT D ERLIG+AA
Sbjct: 28  KEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFT-DSERLIGEAA 86

Query: 431 KNQLTTNPENTVFDAKRLIGREWSDQ 508
           KNQ   NPE TVFD KRLIGR++ D+
Sbjct: 87  KNQAAVNPERTVFDVKRLIGRKFEDK 112



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D K  P+++V K+ KP++QV+   G+ KVF+PEEISAM+L
Sbjct: 114 VQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL 156


>At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)
           SWISS-PROT:Q9LKR3 PMID:8888624
          Length = 669

 Score =  135 bits (327), Expect = 2e-32
 Identities = 69/97 (71%), Positives = 76/97 (78%)
 Frame = +2

Query: 218 FGGRGRLCRRQEEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFT 397
           FG    L    EE  K +G+VIGIDLGTTYSCVGVYKNG VEIIANDQGNRITPS+V FT
Sbjct: 18  FGCLFALSSAIEEATK-LGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFT 76

Query: 398 QDGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDQ 508
            D ERLIG+AAKNQ   NPE TVFD KRLIGR++ D+
Sbjct: 77  -DSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDK 112



 Score = 52.0 bits (119), Expect = 3e-07
 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%)
 Frame = +1

Query: 511 VQHDVKFFPFKVVEKNSKPHVQVQTSQGD-KVFAPEEISAMVL 636
           VQ D K  P+++V K+ KP++QV+   G+ KVF+PEEISAM+L
Sbjct: 114 VQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMIL 156


>At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)
           Similar to Arabidopsis luminal binding protein
           (gb|D89342); contains Pfam domain PF00012: dnaK protein
          Length = 678

 Score =  132 bits (318), Expect = 2e-31
 Identities = 63/85 (74%), Positives = 72/85 (84%)
 Frame = +2

Query: 251 EEKDKDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAA 430
           E +++ +GTVIGIDLGTTYSCVGVY N  VEIIANDQGNRITPS+VAFT D ERLIG+AA
Sbjct: 43  EGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFT-DTERLIGEAA 101

Query: 431 KNQLTTNPENTVFDAKRLIGREWSD 505
           KNQ   NPE T+FD KRLIGR++ D
Sbjct: 102 KNQAAKNPERTIFDPKRLIGRKFDD 126



 Score = 61.7 bits (143), Expect = 4e-10
 Identities = 25/44 (56%), Positives = 35/44 (79%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P VQ D+KF P+KVV K+ KP++QV+    +K+F+PEEISAM+L
Sbjct: 127 PDVQRDIKFLPYKVVNKDGKPYIQVKVKGEEKLFSPEEISAMIL 170


>At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein
           GI:425194 [Spinacia oleracea]
          Length = 650

 Score =  131 bits (317), Expect = 3e-31
 Identities = 64/81 (79%), Positives = 69/81 (85%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+
Sbjct: 4   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQV 62

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 63  AMNPTNTVFDAKRLIGRRYSD 83



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 21/45 (46%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P+VQ D   +PFKVV     KP + V     +K F+ EEIS+MVL
Sbjct: 84  PSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSAEEISSMVL 128


>At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1
           (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}
          Length = 651

 Score =  130 bits (315), Expect = 6e-31
 Identities = 64/81 (79%), Positives = 69/81 (85%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+
Sbjct: 4   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQV 62

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 63  AMNPVNTVFDAKRLIGRRFSD 83



 Score = 38.3 bits (85), Expect = 0.004
 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKV-VEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PFK+      KP + V+    +K FA EEIS+MVL
Sbjct: 85  SVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEISSMVL 128


>At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2
           (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock
           cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis
           thaliana}
          Length = 653

 Score =  130 bits (315), Expect = 6e-31
 Identities = 64/81 (79%), Positives = 69/81 (85%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+
Sbjct: 4   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQV 62

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 63  AMNPVNTVFDAKRLIGRRFSD 83



 Score = 35.1 bits (77), Expect = 0.039
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNS-KPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D + +PF ++   + KP + V+    +K FA EEIS+MVL
Sbjct: 85  SVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEISSMVL 128


>At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein,
           putative / HSC70, putative / HSP70, putative strong
           similarity to heat shock cognate 70 kd protein 1
           SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)]
          Length = 617

 Score =  130 bits (315), Expect = 6e-31
 Identities = 64/81 (79%), Positives = 69/81 (85%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+
Sbjct: 4   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQV 62

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR +SD
Sbjct: 63  AMNPVNTVFDAKRLIGRRFSD 83



 Score = 40.7 bits (91), Expect = 8e-04
 Identities = 22/44 (50%), Positives = 29/44 (65%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNS-KPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+KF+PFKV    + KP + V     +K FA EEIS+MVL
Sbjct: 85  SVQSDMKFWPFKVTPGQADKPMIFVNYKGEEKQFAAEEISSMVL 128


>At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3
           (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock
           cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis
           thaliana}
          Length = 649

 Score =  129 bits (311), Expect = 2e-30
 Identities = 63/81 (77%), Positives = 69/81 (85%)
 Frame = +2

Query: 263 KDIGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQL 442
           K  G  IGIDLGTTYSCVGV+++ RVEIIANDQGNR TPSYVAFT D ERLIGDAAKNQ+
Sbjct: 4   KGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFT-DSERLIGDAAKNQV 62

Query: 443 TTNPENTVFDAKRLIGREWSD 505
             NP NTVFDAKRLIGR ++D
Sbjct: 63  AMNPINTVFDAKRLIGRRFTD 83



 Score = 34.7 bits (76), Expect = 0.052
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +1

Query: 508 TVQHDVKFFPFKVVEKNS-KPHVQVQTSQGDKVFAPEEISAMVL 636
           +VQ D+K +PF +    + KP + V     DK F+ EEIS+M+L
Sbjct: 85  SVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEISSMIL 128


>At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70,
           putative similar to heat shock protein hsp70 GI:1771478
           from [Pisum sativum]
          Length = 646

 Score =  128 bits (310), Expect = 2e-30
 Identities = 62/75 (82%), Positives = 67/75 (89%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPEN 460
           IGIDLGTTYSCVGV+ N RVEII NDQGNR TPSYVAFT D ERLIGDAAKNQ+  NP+N
Sbjct: 9   IGIDLGTTYSCVGVWMNDRVEIIPNDQGNRTTPSYVAFT-DTERLIGDAAKNQVALNPQN 67

Query: 461 TVFDAKRLIGREWSD 505
           TVFDAKRLIGR++SD
Sbjct: 68  TVFDAKRLIGRKFSD 82



 Score = 44.0 bits (99), Expect = 8e-05
 Identities = 22/45 (48%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P+VQ D+  +PFKVV     KP + V     +K F+PEEIS+MVL
Sbjct: 83  PSVQSDILHWPFKVVSGPGEKPMIVVSYKNEEKQFSPEEISSMVL 127


>At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial,
           putative / HSP70, mitochondrial, putative strong
           similarity to SP|Q01899 Heat shock 70 kDa protein,
           mitochondrial precursor {Phaseolus vulgaris}
          Length = 682

 Score = 91.9 bits (218), Expect = 3e-19
 Identities = 45/92 (48%), Positives = 56/92 (60%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT SCV V +     +I N +G+R TPS VA  Q GE L+G  AK Q  TNP 
Sbjct: 54  VIGIDLGTTNSCVSVMEGKTARVIENAEGSRTTPSVVAMNQKGELLVGTPAKRQAVTNPT 113

Query: 458 NTVFDAKRLIGREWSDQLYNMMLSSSPSRSLK 553
           NT+F +KRLIGR + D      +   P + +K
Sbjct: 114 NTIFGSKRLIGRRFDDPQTQKEMKMVPYKIVK 145


>At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein 70
           [Arabidopsis thaliana] GI:6746592; similar to heat shock
           70 protein - Spinacia oleracea,PID:g2654208
          Length = 718

 Score = 88.2 bits (209), Expect = 4e-18
 Identities = 39/76 (51%), Positives = 51/76 (67%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT S V   + G+  I+ N +G R TPS VA+T+ G+RL+G  AK Q   NPE
Sbjct: 80  VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSGDRLVGQIAKRQAVVNPE 139

Query: 458 NTVFDAKRLIGREWSD 505
           NT F  KR IGR+ ++
Sbjct: 140 NTFFSVKRFIGRKMNE 155


>At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746590
          Length = 682

 Score = 87.0 bits (206), Expect = 9e-18
 Identities = 43/76 (56%), Positives = 50/76 (65%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           VIGIDLGTT SCV V +    ++I N +G R TPS VAF   GE L+G  AK Q  TNP 
Sbjct: 59  VIGIDLGTTNSCVAVMEGKNPKVIENAEGARTTPSVVAFNTKGELLVGTPAKRQAVTNPT 118

Query: 458 NTVFDAKRLIGREWSD 505
           NTV   KRLIGR++ D
Sbjct: 119 NTVSGTKRLIGRKFDD 134


>At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746592
          Length = 718

 Score = 84.6 bits (200), Expect = 5e-17
 Identities = 38/76 (50%), Positives = 49/76 (64%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE 457
           V+GIDLGTT S V   + G+  I+ N +G R TPS VA+T+  +RL+G  AK Q   NPE
Sbjct: 80  VVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSKDRLVGQIAKRQAVVNPE 139

Query: 458 NTVFDAKRLIGREWSD 505
           NT F  KR IGR  ++
Sbjct: 140 NTFFSVKRFIGRRMNE 155


>At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam
           profile: PF00012 Heat shock hsp70 proteins; similar to
           heat-shock proteins GB:CAA94389, GB:AAD55461
           [Arabidopsis thaliana]
          Length = 831

 Score = 64.1 bits (149), Expect = 7e-11
 Identities = 32/88 (36%), Positives = 48/88 (54%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D G     V V +   ++++ ND+ NR TP+ V F  D +R IG A       NP
Sbjct: 2   SVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFG-DKQRFIGTAGAASTMMNP 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
           +N++   KRLIGR++SD      + S P
Sbjct: 61  KNSISQIKRLIGRQFSDPELQRDIKSLP 88



 Score = 27.9 bits (59), Expect = 6.0
 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVE-KNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           P +Q D+K  PF V E  +  P +        + F P ++  M+L
Sbjct: 78  PELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVMGMML 122


>At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 64.1 bits (149), Expect = 7e-11
 Identities = 32/88 (36%), Positives = 48/88 (54%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D G     V V +   ++++ ND+ NR TP+ V F  D +R IG A       NP
Sbjct: 2   SVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFG-DKQRFIGTAGAASTMMNP 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
           +N++   KRLIGR++SD      + S P
Sbjct: 61  KNSISQIKRLIGRQFSDPELQRDIKSLP 88


>At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 64.1 bits (149), Expect = 7e-11
 Identities = 32/88 (36%), Positives = 48/88 (54%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D G     V V +   ++++ ND+ NR TP+ V F  D +R IG A       NP
Sbjct: 2   SVVGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFG-DKQRFIGTAGAASTMMNP 60

Query: 455 ENTVFDAKRLIGREWSDQLYNMMLSSSP 538
           +N++   KRLIGR++SD      + S P
Sbjct: 61  KNSISQIKRLIGRQFSDPELQRDIKSLP 88


>At1g11660.1 68414.m01339 heat shock protein, putative strong
           similarity to gb|Z70314 heat-shock protein from
           Arabidopsis thaliana and is a member of the PF|00012
           Hsp70 protein family
          Length = 773

 Score = 57.2 bits (132), Expect = 9e-09
 Identities = 26/77 (33%), Positives = 47/77 (61%)
 Frame = +2

Query: 275 TVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNP 454
           +V+G D+G     + V K   ++++ ND+ NR  P+ V+F +  +R +G AA    T +P
Sbjct: 2   SVVGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEK-QRFMGAAAAASATMHP 60

Query: 455 ENTVFDAKRLIGREWSD 505
           ++T+   KRLIGR++ +
Sbjct: 61  KSTISQLKRLIGRKFRE 77



 Score = 27.9 bits (59), Expect = 6.0
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 2/46 (4%)
 Frame = +1

Query: 505 PTVQHDVKFFPFKVVEKNSKPHVQVQTSQGDKV--FAPEEISAMVL 636
           P VQ+D++ FPF+  E +S   +Q++     ++  F+P +I  M+L
Sbjct: 78  PDVQNDLRLFPFETSE-DSDGGIQIRLRYMGEIQSFSPVQILGMLL 122


>At2g32120.2 68415.m03926 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE- 457
           +GID+GT+   + V+   +V I+ N +  ++  S+V F    + +      NQL    E 
Sbjct: 31  LGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFK---DEVPAGGVSNQLAHEQEM 87

Query: 458 ---NTVFDAKRLIGREWSD 505
                +F+ KRL+GR  +D
Sbjct: 88  LTGAAIFNMKRLVGRVDTD 106


>At2g32120.1 68415.m03925 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)
 Frame = +2

Query: 281 IGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLTTNPE- 457
           +GID+GT+   + V+   +V I+ N +  ++  S+V F    + +      NQL    E 
Sbjct: 31  LGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFK---DEVPAGGVSNQLAHEQEM 87

Query: 458 ---NTVFDAKRLIGREWSD 505
                +F+ KRL+GR  +D
Sbjct: 88  LTGAAIFNMKRLVGRVDTD 106


>At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70,
           putative
          Length = 867

 Score = 37.5 bits (83), Expect = 0.007
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +2

Query: 278 VIGIDLGTTYSCVGVY--KNGR--VEIIANDQGNRITPSYVAFTQDGERLIGDAAKNQLT 445
           V+ +DLG+ +  V V   K G+  + +  N+   R +P+ VAF Q G+RL+G+ A     
Sbjct: 26  VLSVDLGSEWVKVAVVNLKRGQSPISVAINEMSKRKSPALVAF-QSGDRLLGEEAAGITA 84

Query: 446 TNPENTVFDAKRLIGR 493
             P       + ++G+
Sbjct: 85  RYPNKVYSQLRDMVGK 100



 Score = 29.5 bits (63), Expect = 2.0
 Identities = 14/39 (35%), Positives = 24/39 (61%)
 Frame = +1

Query: 520 DVKFFPFKVVEKNSKPHVQVQTSQGDKVFAPEEISAMVL 636
           D  + PF +VE +S+  V ++   G  V++ EE+ AM+L
Sbjct: 110 DSVYLPFDIVE-DSRGAVGIKIDDGSTVYSVEELLAMIL 147


>At1g22190.1 68414.m02775 AP2 domain-containing transcription
           factor, putative similar to AP2 domain containing
           protein RAP2.4 GI:2281633 from [Arabidopsis thaliana]
          Length = 261

 Score = 31.1 bits (67), Expect = 0.64
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = -1

Query: 333 PFL*TPTHE*-VVPKSIPITVPMSLSFSSCRRHKRPRPPKLARTNSTAS*PCKIYR 169
           PF+ +P+++      S+P  +       S   H  P+P  + +T ++A+ P K+YR
Sbjct: 29  PFIKSPSNDSSAFAFSLPAPISYGSDLHSFSHHLSPKPVSMKQTGTSAAKPTKLYR 84


>At5g23520.1 68418.m02760 expressed protein 
          Length = 435

 Score = 28.7 bits (61), Expect = 3.4
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +2

Query: 206 VRASFGGRGRLCRRQEEKDKDIGTVI 283
           V ASFG RGRL R  E  +K   +V+
Sbjct: 40  VNASFGVRGRLRRNHEPSEKSFSSVL 65


>At5g01550.1 68418.m00070 lectin protein kinase, putative similar to
           receptor lectin kinase 3 [Arabidopsis thaliana]
           gi|4100060|gb|AAD00733; contains protein kinase domain,
           Pfam:PF00069; contains legume lectins alpha and beta
           domains, Pfam:PF00138 and Pfam:PF00139
          Length = 688

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 14/34 (41%), Positives = 21/34 (61%)
 Frame = -1

Query: 561 AVLFNDLEGEELNIMLYSWSLHSRPIRRLASKTV 460
           A+L  D   + LN+ +Y  +L SRP+R L S+ V
Sbjct: 203 AILDYDGPTQTLNLTVYPANLKSRPVRPLISRPV 236


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,985,698
Number of Sequences: 28952
Number of extensions: 296978
Number of successful extensions: 840
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 789
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 819
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1305036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -