SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20067
         (619 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g62960.1 68414.m07109 1-aminocyclopropane-1-carboxylate synth...    30   1.4  
At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar...    29   1.9  
At3g23110.1 68416.m02913 disease resistance family protein conta...    29   2.5  
At2g06140.1 68415.m00675 hypothetical protein                          29   2.5  
At3g11330.1 68416.m01378 leucine-rich repeat family protein            28   4.3  
At5g20170.1 68418.m02402 expressed protein                             27   7.5  
At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, put...    27   10.0 
At1g74190.1 68414.m08592 leucine-rich repeat family protein cont...    27   10.0 
At1g69200.1 68414.m07921 pfkB-type carbohydrate kinase family pr...    27   10.0 

>At1g62960.1 68414.m07109 1-aminocyclopropane-1-carboxylate
           synthase, putative / ACC synthase, putative similar to
           GI:1173638 [GB:U35779] from [Triticum aestivum] (Plant
           Mol. Biol. 31 (5), 1009-1020 (1996)), GI:1813331 from
           Vigna radiata
          Length = 557

 Score = 29.9 bits (64), Expect = 1.4
 Identities = 13/62 (20%), Positives = 31/62 (50%)
 Frame = +3

Query: 153 SANLSIKPSRKTKTPTTYWINMRITNPRNTKRFCQRGQALSQRLHMLCISGIQTSQVQLP 332
           SA+  +       +PT + +   I+NP+N +RF +  +   Q ++   + G++   ++  
Sbjct: 415 SASRKLTTLSPVSSPTQHLLISAISNPKNVQRFVKTNRQRLQSIYTELVEGLKELGIECT 474

Query: 333 RN 338
           R+
Sbjct: 475 RS 476


>At1g08590.1 68414.m00952 CLAVATA1 receptor kinase (CLV1) similar to
           receptor-like protein kinase (Ipomoea nil) (U77888)
          Length = 1029

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +1

Query: 391 DPRYPINLDDFMFKKLGLHQVATVKIVNSTIGYIAP 498
           D      + DF   K+ LH+  TV +V  + GYIAP
Sbjct: 863 DSNLEARIADFGLAKMMLHKNETVSMVAGSYGYIAP 898


>At3g23110.1 68416.m02913 disease resistance family protein contains
           leucine rich-repeat (LRR) domains Pfam:PF00560,
           INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon
           pimpinellifolium] gi|1184077|gb|AAC15780
          Length = 835

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +2

Query: 494 PQCFPGVHDLYAVNLSNNNLKSLHPE 571
           PQC     D Y +NL NN+L    P+
Sbjct: 466 PQCLKNSTDFYMLNLRNNSLSGFMPD 491


>At2g06140.1 68415.m00675 hypothetical protein 
          Length = 633

 Score = 29.1 bits (62), Expect = 2.5
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +2

Query: 158 ESINKTVKKDKDADNLLDQYEDYEPAEYQE 247
           ES+++ +  DK  DNL  + E +EP E +E
Sbjct: 588 ESLDRILDLDKKVDNLTTRIEGHEPMESEE 617


>At3g11330.1 68416.m01378 leucine-rich repeat family protein
          Length = 499

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +2

Query: 479 RLVISPQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           +L + P+ F  +  L  +NLSNN L+S+ P++ A
Sbjct: 209 KLRLLPEAFGRIQGLLVLNLSNNKLESI-PDSIA 241


>At5g20170.1 68418.m02402 expressed protein 
          Length = 654

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = +2

Query: 167 NKTVKKDKDADNLLDQYEDYEPAEYQEVLSTRTGPVPETAYALYLR 304
           N ++KK + A  L++     EPAE  +    + G    T+Y +YL+
Sbjct: 341 NPSIKKSESATLLIESSGRVEPAEGGDYRLKKLGFPNRTSYEIYLQ 386


>At2g04300.1 68415.m00422 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 851

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 11/27 (40%), Positives = 15/27 (55%)
 Frame = +2

Query: 494 PQCFPGVHDLYAVNLSNNNLKSLHPET 574
           P+   G+  L  +NLS NNL    P+T
Sbjct: 415 PEFLAGLKSLLVINLSGNNLSGSVPQT 441


>At1g74190.1 68414.m08592 leucine-rich repeat family protein
           contains leucine rich-repeat (LRR) domains Pfam:PF00560,
           INTERPRO:IPR001611; contains similarity to Cf-2.1
           [Lycopersicon pimpinellifolium] gi|1184075|gb|AAC15779
          Length = 965

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 12/29 (41%), Positives = 20/29 (68%)
 Frame = +2

Query: 494 PQCFPGVHDLYAVNLSNNNLKSLHPETFA 580
           P  F G+ +L A+NLS+NNL  + P++ +
Sbjct: 796 PVEFGGLLELRALNLSHNNLSGVIPKSIS 824


>At1g69200.1 68414.m07921 pfkB-type carbohydrate kinase family
           protein contains Pfam profile: PF00294 pfkB family
           carbohydrate kinase
          Length = 614

 Score = 27.1 bits (57), Expect = 10.0
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +2

Query: 170 KTVKKDKDADNLLDQYEDYEPAEYQEVLSTRT 265
           +TVKKDKD ++ L    D E ++ +E L+  +
Sbjct: 146 RTVKKDKDVEDDLATIMDAEVSDVEEALAVES 177


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,761,718
Number of Sequences: 28952
Number of extensions: 253532
Number of successful extensions: 823
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 790
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 823
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1246162608
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -