SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20065
         (649 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g51960.1 68414.m05857 calmodulin-binding family protein conta...    29   2.0  
At5g37760.1 68418.m04545 DNAJ heat shock N-terminal domain-conta...    29   2.7  
At2g15580.1 68415.m01784 zinc finger (C3HC4-type RING finger) fa...    28   4.7  
At1g05410.1 68414.m00549 expressed protein                             28   4.7  
At3g27290.1 68416.m03411 F-box family protein-related contains w...    28   6.1  

>At1g51960.1 68414.m05857 calmodulin-binding family protein contains
           IQ calmodulin-binding motif, Pfam:PF00612
          Length = 351

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 13/40 (32%), Positives = 19/40 (47%)
 Frame = -2

Query: 549 YEGSFIFHIESLQKIFSSASFYFKRRQNLQKGYHHPLENS 430
           YEG F++    L+  FS   + F   QN  +  HH   N+
Sbjct: 225 YEGDFVYKGNDLELCFSDEKWKFATAQNTPRLLHHHSANN 264


>At5g37760.1 68418.m04545 DNAJ heat shock N-terminal
           domain-containing protein contains Pfam profile PF00226:
           DnaJ domain
          Length = 207

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +2

Query: 284 YTSVSCDSKRHIVRHISPVLGVNPLF*LHSKYEIEN 391
           +TS    S+ H  RHI+P++GV+ +F L    ++EN
Sbjct: 9   FTSALTSSEDHGRRHIAPLIGVDGIF-LKCTLKVEN 43


>At2g15580.1 68415.m01784 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 196

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = -2

Query: 219 HRTELGHVFFDE-SLRFRSYRIGDDKFLDGAA 127
           H +   HV F E S+R +SY   +D+ LDGAA
Sbjct: 52  HESHQAHVSFSERSVRNKSYGEDNDEKLDGAA 83


>At1g05410.1 68414.m00549 expressed protein
          Length = 471

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 11/33 (33%), Positives = 16/33 (48%)
 Frame = -3

Query: 317 CDVCCHMTLTCTNCYALICAVRT*SASSGGRLY 219
           CD+CC     C +C  ++C  +  S   GG  Y
Sbjct: 174 CDICCGERKFCVDCCCILCC-KLISLEHGGYSY 205


>At3g27290.1 68416.m03411 F-box family protein-related contains weak
           similarity to PPA [Mus musculus] GP|18568225|gb|AAL75967
          Length = 382

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 3/35 (8%)
 Frame = -3

Query: 350 SHRALARCVERCDVCCHMTLTCTN---CYALICAV 255
           S RA   C+ERC  C      C N   C+A  C V
Sbjct: 339 SCRACVVCIERCHECGSCLNDCENKPFCFAFSCVV 373


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,280,840
Number of Sequences: 28952
Number of extensions: 274461
Number of successful extensions: 618
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 608
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 618
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -