SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20064
         (713 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g21150.1 68417.m03057 ribophorin II (RPN2) family protein con...    31   1.0  
At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ...    29   3.1  
At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ...    29   3.1  
At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10...    29   3.1  
At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10...    29   3.1  
At4g35420.1 68417.m05031 dihydroflavonol 4-reductase family / di...    29   4.0  
At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) fa...    28   5.3  
At4g33530.1 68417.m04765 potassium transporter family protein si...    28   7.1  
At3g30560.1 68416.m03867 hypothetical protein                          28   7.1  
At5g14280.1 68418.m01670 DNA-binding storekeeper protein-related...    27   9.3  

>At4g21150.1 68417.m03057 ribophorin II (RPN2) family protein
           contains Pfam domain PF05817: Ribophorin II (RPN2)
          Length = 691

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 14/34 (41%), Positives = 26/34 (76%), Gaps = 2/34 (5%)
 Frame = +3

Query: 300 VGSMTIMYLLIWL-LDL-NTLASIAIVGLILNFV 395
           +G++ ++Y+L WL LDL  TL +++++G+ L FV
Sbjct: 640 IGAVLLLYVLFWLKLDLFTTLKALSLLGVFLLFV 673


>At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40
            repeats domain (PF00400) (6 weak)
          Length = 1120

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +1

Query: 142  DNFIAKMGEKSSTVQDQEQQVRKVKRTLEGWRVALLSLSL*YCGNNNGILVPLWAQ*QLC 321
            DN I  +G   ST+Q    +V +VK  L+G    +  L+     N   +LV   A  QLC
Sbjct: 877  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAF---SNVLNVLVSSGADAQLC 933

Query: 322  IFS 330
            +++
Sbjct: 934  VWN 936


>At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40
            repeats domain (PF00400) (6 weak)
          Length = 1120

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +1

Query: 142  DNFIAKMGEKSSTVQDQEQQVRKVKRTLEGWRVALLSLSL*YCGNNNGILVPLWAQ*QLC 321
            DN I  +G   ST+Q    +V +VK  L+G    +  L+     N   +LV   A  QLC
Sbjct: 877  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAF---SNVLNVLVSSGADAQLC 933

Query: 322  IFS 330
            +++
Sbjct: 934  VWN 936


>At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10
            WD-40 repeats (PF00400) (1 weak)
          Length = 1131

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +1

Query: 142  DNFIAKMGEKSSTVQDQEQQVRKVKRTLEGWRVALLSLSL*YCGNNNGILVPLWAQ*QLC 321
            DN I  +G   ST+Q    +V +VK  L+G    +  L+     N   +LV   A  QLC
Sbjct: 888  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAF---SNVLNVLVSSGADAQLC 944

Query: 322  IFS 330
            +++
Sbjct: 945  VWN 947


>At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10
            WD-40 repeats (PF00400) (1 weak)
          Length = 1131

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 20/63 (31%), Positives = 31/63 (49%)
 Frame = +1

Query: 142  DNFIAKMGEKSSTVQDQEQQVRKVKRTLEGWRVALLSLSL*YCGNNNGILVPLWAQ*QLC 321
            DN I  +G   ST+Q    +V +VK  L+G    +  L+     N   +LV   A  QLC
Sbjct: 888  DNNIIAIGMDDSTIQIYNVRVDEVKSKLKGHSKRITGLAF---SNVLNVLVSSGADAQLC 944

Query: 322  IFS 330
            +++
Sbjct: 945  VWN 947


>At4g35420.1 68417.m05031 dihydroflavonol 4-reductase family /
           dihydrokaempferol 4-reductase family similar to
           dihydroflavonol 4-reductase (Rosa hybrid cultivar,
           GI:1332411), CPRD14 protein (Vigna unguiculata,
           GI:1854445)
          Length = 326

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = -2

Query: 328 RRYIIVIEPTMAQGCHCCSHNITDLERV 245
           R +I+V E   AQG + CS N+  LE +
Sbjct: 235 RTHIVVFEHEAAQGRYICSSNVISLEEL 262


>At5g23110.1 68418.m02703 zinc finger (C3HC4-type RING finger) family
            protein contains Pfam profile: PF00097 zinc finger, C3HC4
            type (RING finger)
          Length = 4706

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 12/30 (40%), Positives = 17/30 (56%)
 Frame = +3

Query: 339  LDLNTLASIAIVGLILNFVDFMVPVICNQL 428
            ++L+TLA   I  ++LNF  F     CN L
Sbjct: 3959 VELSTLAGSVIEAILLNFAGFYSTAFCNTL 3988


>At4g33530.1 68417.m04765 potassium transporter family protein
           similar to K+ transporter HAK5 [Arabidopsis thaliana]
           GI:7108597; KUP/HAK/KT Transporter family member,
           PMID:11500563; contains Pfam profile PF02705: K+
           potassium transporter
          Length = 855

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/46 (32%), Positives = 26/46 (56%)
 Frame = +3

Query: 309 MTIMYLLIWLLDLNTLASIAIVGLILNFVDFMVPVICNQLYGSSSW 446
           +T++ LLIW  ++  ++  AIV LI+  V F    +C+ +    SW
Sbjct: 517 VTLIMLLIWQTNIIVVSMFAIVSLIVELVFF--SSVCSSV-ADGSW 559


>At3g30560.1 68416.m03867 hypothetical protein
          Length = 1473

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 3/38 (7%)
 Frame = -1

Query: 326 KIHNCH*AHNGTRMPLLFPQ---YYRLRESKATRQPSK 222
           +IH CH ++   + PLLFP+    YRL   K     SK
Sbjct: 338 RIHECHVSYLSLQYPLLFPKGEDGYRLGIKKTETNTSK 375


>At5g14280.1 68418.m01670 DNA-binding storekeeper protein-related
           contains similarity to storekeeper protein [Solanum
           tuberosum] gi|14268476|emb|CAC39398; contains PF04504:
           Protein of unknown function, DUF573
          Length = 572

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 15/44 (34%), Positives = 21/44 (47%)
 Frame = +1

Query: 559 YVLHYLHQYIVYCSLDILFY*QHFPVVFIVNSSTALAWHTAHGI 690
           Y L  L  YIV+   D+LF   H   +F+  +   L +H A  I
Sbjct: 408 YFLTDLFHYIVFNPNDVLFIGHHVATLFVFLTCRFLVFHGACAI 451


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,170,843
Number of Sequences: 28952
Number of extensions: 302510
Number of successful extensions: 759
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 743
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 759
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1545769616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -