SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20063
         (681 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) riboso...   139   2e-33
At5g07090.1 68418.m00804 40S ribosomal protein S4 (RPS4B)             138   3e-33
At2g17360.1 68415.m02005 40S ribosomal protein S4 (RPS4A) contai...   138   3e-33
At4g10710.1 68417.m01751 transcriptional regulator-related simil...    31   0.71 
At3g13225.1 68416.m01660 WW domain-containing protein contains P...    29   2.8  
At2g38050.1 68415.m04671 3-oxo-5-alpha-steroid 4-dehydrogenase, ...    29   2.8  
At2g24050.1 68415.m02873 MIF4G domain-containing protein / MA3 d...    28   6.6  
At2g38570.1 68415.m04738 expressed protein ; expression supporte...    27   8.7  

>At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) ribosomal
           protein S4, Arabidopsis thaliana, PIR:T48480
          Length = 262

 Score =  139 bits (336), Expect = 2e-33
 Identities = 71/132 (53%), Positives = 83/132 (62%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD TYPAGFMDVVSI KTNE FRL+YD KGRF +H I  EEAK+KLCKV+ +  G
Sbjct: 73  DGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K +PYL T+DGRTIRYPDPLIK        L+  ++        G  V        G  
Sbjct: 133 QKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRV 192

Query: 615 APSCSRERHPGS 650
               +RE+H GS
Sbjct: 193 GVIKNREKHKGS 204



 Score =  122 bits (295), Expect = 2e-28
 Identities = 56/75 (74%), Positives = 64/75 (85%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPLV+ +RNRLKYALT  E
Sbjct: 1   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V+ I+ QR I+V GK
Sbjct: 61  VISILMQRHIQVDGK 75



 Score = 67.7 bits (158), Expect = 7e-12
 Identities = 30/63 (47%), Positives = 43/63 (68%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I+LD+   KI++FIKF+ GN+ M+TGGRN GRVG I    +    F+ +HI+
Sbjct: 152 PLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQ 211

Query: 671 DST 679
           DST
Sbjct: 212 DST 214


>At5g07090.1 68418.m00804 40S ribosomal protein S4 (RPS4B)
          Length = 262

 Score =  138 bits (334), Expect = 3e-33
 Identities = 71/132 (53%), Positives = 83/132 (62%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD TYPAGFMDVVSI KTNE FRL+YD KGRF +H I  EEAK+KLCKV+ +  G
Sbjct: 73  DGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K +PYL T+DGRTIRYPDPLIK        L+  ++        G  V        G  
Sbjct: 133 QKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRV 192

Query: 615 APSCSRERHPGS 650
               +RE+H GS
Sbjct: 193 GVIKNREKHKGS 204



 Score =  122 bits (295), Expect = 2e-28
 Identities = 56/75 (74%), Positives = 64/75 (85%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPLV+ +RNRLKYALT  E
Sbjct: 1   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V+ I+ QR I+V GK
Sbjct: 61  VISILMQRHIQVDGK 75



 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 30/63 (47%), Positives = 43/63 (68%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I+LD+   KI++FIKF+ GN+ M+TGGRN GRVG I    +    F+ +HI+
Sbjct: 152 PLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQ 211

Query: 671 DST 679
           DST
Sbjct: 212 DST 214


>At2g17360.1 68415.m02005 40S ribosomal protein S4 (RPS4A) contains
           ribosomal protein S4 signature from residues 8 to 22
          Length = 261

 Score =  138 bits (334), Expect = 3e-33
 Identities = 71/132 (53%), Positives = 83/132 (62%)
 Frame = +3

Query: 255 DGKVRTDPTYPAGFMDVVSIEKTNELFRLIYDVKGRFTIHRITPEEAKYKLCKVKRVATG 434
           DGKVRTD TYPAGFMDVVSI KTNE FRL+YD KGRF +H I  EEAK+KLCKV+ +  G
Sbjct: 73  DGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFG 132

Query: 435 PKNVPYLVTHDGRTIRYPDPLIKVKIPSS*TLQLRRLWTSSSLSPGTCV*SREAVTWGVW 614
            K +PYL T+DGRTIRYPDPLIK        L+  ++        G  V        G  
Sbjct: 133 QKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRV 192

Query: 615 APSCSRERHPGS 650
               +RE+H GS
Sbjct: 193 GVIKNREKHKGS 204



 Score =  122 bits (295), Expect = 2e-28
 Identities = 56/75 (74%), Positives = 64/75 (85%)
 Frame = +1

Query: 40  MARGPKKHLKRLNAPKAWMLDKLGGVYAPRPSTGPHKLRECLPLVIFLRNRLKYALTGNE 219
           MARG KKHLKRLNAPK WMLDKLGG +AP+PS+GPHK RECLPLV+ +RNRLKYALT  E
Sbjct: 1   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE 60

Query: 220 VLKIVKQRLIKVMGK 264
           V+ I+ QR I+V GK
Sbjct: 61  VISILMQRHIQVDGK 75



 Score = 67.3 bits (157), Expect = 9e-12
 Identities = 30/63 (47%), Positives = 43/63 (68%)
 Frame = +2

Query: 491 PTYQSQDSIQLDIATTKIMDFIKFESGNLCMITGGRNLGRVGTIVFPRETSRLFDIVHIK 670
           P  +  D+I+LD+   KI++FIKF+ GN+ M+TGGRN GRVG I    +    F+ +HI+
Sbjct: 152 PLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQ 211

Query: 671 DST 679
           DST
Sbjct: 212 DST 214


>At4g10710.1 68417.m01751 transcriptional regulator-related similar
           to chromatin-specific transcription elongation factor
           FACT 140 kDa subunit (GI:5499741) [Homo sapiens]
          Length = 1074

 Score = 31.1 bits (67), Expect = 0.71
 Identities = 12/27 (44%), Positives = 16/27 (59%)
 Frame = -2

Query: 164 KHSRNLWGPVDGLGAYTPPSLSNIHAL 84
           KHS +LWG  D L   TPP+  ++  L
Sbjct: 44  KHSADLWGSADALAIATPPASDDLRYL 70


>At3g13225.1 68416.m01660 WW domain-containing protein contains Pfam
           profile PF00397: WW domain
          Length = 863

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 5/63 (7%)
 Frame = +3

Query: 135 NRSPQVARVLAPGDFPEESSEVCFDRK-----RSPENCETTPHKGDGKVRTDPTYPAGFM 299
           N+SP   +++A  +   ES +   D +     +S  + E+    GDG  +  P +PAG  
Sbjct: 388 NKSPPKEKLVADANTESESEDSERDGELAQSGKSLHSDESADGSGDGSPKHSPNHPAGQS 447

Query: 300 DVV 308
           D++
Sbjct: 448 DII 450


>At2g38050.1 68415.m04671 3-oxo-5-alpha-steroid 4-dehydrogenase,
           putative / steroid 5-alpha-reductase, putative identical
           to gi:1280611; contains a steroid 5-alpha reductase,
           C-terminal domain
          Length = 262

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 15/39 (38%), Positives = 19/39 (48%)
 Frame = -2

Query: 254 TFMRRCFTIFRTSFPVKAYFRRFLRKITRGKHSRNLWGP 138
           TF R C      + P  A   +FL+    GKH+R  WGP
Sbjct: 8   TFFRYCLLTLIFAGPPTAVLLKFLQA-PYGKHNRTGWGP 45


>At2g24050.1 68415.m02873 MIF4G domain-containing protein / MA3
           domain-containing protein similar to SP|Q03387
           Eukaryotic initiation factor (iso)4F subunit P82-34
           (eIF-(iso)4F P82-34) {Triticum aestivum}; contains Pfam
           profiles PF02854: MIF4G domain, PF02847: MA3 domain
          Length = 747

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = -1

Query: 657 MSKSRDVSRGNTMVPTRPKLRPPVIIHK 574
           M+++R + RGN     +P+ +PP  I+K
Sbjct: 484 MARTRSMPRGNRQTVQQPRFQPPPAINK 511


>At2g38570.1 68415.m04738 expressed protein ; expression supported
           by MPSS
          Length = 302

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 12/28 (42%), Positives = 17/28 (60%)
 Frame = +2

Query: 536 TKIMDFIKFESGNLCMITGGRNLGRVGT 619
           T I+ +IK   G   +  GGRN+G+V T
Sbjct: 196 TYILVYIKISVGYRVVTPGGRNIGKVST 223


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,528,115
Number of Sequences: 28952
Number of extensions: 366118
Number of successful extensions: 1055
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1007
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1055
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1438152744
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -