SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20062
         (635 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g33650.1 68417.m04780 dynamin-like protein 2a (ADL2a) identic...   129   2e-30
At2g14120.2 68415.m01573 dynamin-like protein 2b (ADL2b) identic...   120   8e-28
At2g14120.1 68415.m01572 dynamin-like protein 2b (ADL2b) identic...   120   8e-28
At3g60190.1 68416.m06724 dynamin-like protein E (DL1E) nearly id...   111   5e-25
At1g14830.1 68414.m01774 dynamin-like protein C (DL1C) nearly id...   108   3e-24
At3g61760.1 68416.m06927 dynamin-like protein B (DL1B) identical...   106   1e-23
At2g44590.3 68415.m05551 dynamin-like protein D (DL1D) identical...   105   2e-23
At5g42080.2 68418.m05123 GTP-binding protein / phragmoplastin, p...   104   4e-23
At5g42080.1 68418.m05122 GTP-binding protein / phragmoplastin, p...   104   4e-23
At2g44590.2 68415.m05550 dynamin-like protein D (DL1D) identical...   102   2e-22
At2g44590.1 68415.m05549 dynamin-like protein D (DL1D) identical...   102   2e-22
At1g60500.1 68414.m06811 dynamin family protein similar to RBTMx...    61   7e-10
At1g60540.1 68414.m06815 dynamin family protein similar to SP|Q9...    58   4e-09
At1g60530.1 68414.m06814 dynamin family protein similar to mx2 p...    58   4e-09
At1g10290.1 68414.m01159 dynamin-like protein 6 (ADL6) identical...    51   7e-07
At1g59610.1 68414.m06704 dynamin-like protein, putative (ADL3) s...    48   5e-06
At5g37890.1 68418.m04565 seven in absentia (SINA) protein, putat...    32   0.28 
At1g53140.1 68414.m06017 dynamin family protein low similarity t...    29   2.0  
At5g07830.1 68418.m00898 glycosyl hydrolase family 79 N-terminal...    29   2.6  
At1g28260.2 68414.m03469 expressed protein                             29   2.6  
At1g28260.1 68414.m03468 expressed protein                             29   2.6  
At1g76170.1 68414.m08845 expressed protein  contains Pfam profil...    28   6.0  
At1g54380.1 68414.m06200 spliceosome protein-related contains Pf...    27   7.9  

>At4g33650.1 68417.m04780 dynamin-like protein 2a (ADL2a) identical
           to dynamin like protein 2a (ADL2a) [Arabidopsis
           thaliana] GI:19032337; supported by cDNA gi:19032336
          Length = 808

 Score =  129 bits (311), Expect = 2e-30
 Identities = 59/93 (63%), Positives = 78/93 (83%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI  +I++++CLILAVTPANTDLANSDAL++A  VDP G RTIGVITKLD+MD+GT
Sbjct: 191 RIRTMILSYIKQDTCLILAVTPANTDLANSDALQIASIVDPDGHRTIGVITKLDIMDKGT 250

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DAR +L   ++PLR GY+GVVNRC++ + + RT
Sbjct: 251 DARKLLLGNVVPLRLGYVGVVNRCQEDILLNRT 283



 Score =  104 bits (250), Expect = 4e-23
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +2

Query: 5   TRQLINGNT--EYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSP 178
           T+   NG +  E+ EF H    +F DF+E+R EIEAET+R+ G NKG++   I L++ SP
Sbjct: 104 TKSRANGGSDDEWGEFRHLPETRFYDFSEIRREIEAETNRLVGENKGVADTQIRLKISSP 163

Query: 179 NVLNLTLIDLPGLTKVPIGDQPIDI 253
           NVLN+TL+DLPG+TKVP+GDQP DI
Sbjct: 164 NVLNITLVDLPGITKVPVGDQPSDI 188



 Score = 41.1 bits (92), Expect = 6e-04
 Identities = 20/35 (57%), Positives = 23/35 (65%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q+DI   + +  AL AE KFF SHP Y  LADRLG
Sbjct: 275 QEDILLNRTVKEALLAEEKFFRSHPVYHGLADRLG 309


>At2g14120.2 68415.m01573 dynamin-like protein 2b (ADL2b) identical
           to dynamin like protein 2b (ADL2b) [Arabidopsis
           thaliana] GI:19032339
          Length = 780

 Score =  120 bits (289), Expect = 8e-28
 Identities = 57/93 (61%), Positives = 73/93 (78%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI  +I+  SCLILAV+PANTDLANSDAL++A   DP G RTIGVITKLD+MD GT
Sbjct: 176 RIRTMILTYIKEPSCLILAVSPANTDLANSDALQIAGNADPDGHRTIGVITKLDIMDRGT 235

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DAR+ L  K +PLR GY+GVVNR ++ + + R+
Sbjct: 236 DARNHLLGKTIPLRLGYVGVVNRSQEDILMNRS 268



 Score =  104 bits (250), Expect = 4e-23
 Identities = 45/75 (60%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EYAEFLHCKG-KKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDL 208
           E+ EFLH    ++  DF+E+R EIEAET+RV+G NKG+S +PI L+++SPNVL+++L+DL
Sbjct: 99  EWGEFLHHDPVRRIYDFSEIRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDL 158

Query: 209 PGLTKVPIGDQPIDI 253
           PG+TKVP+GDQP DI
Sbjct: 159 PGITKVPVGDQPSDI 173



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 19/35 (54%), Positives = 21/35 (60%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q+DI   + I  AL AE KFF S P Y  L DRLG
Sbjct: 260 QEDILMNRSIKDALVAEEKFFRSRPVYSGLTDRLG 294


>At2g14120.1 68415.m01572 dynamin-like protein 2b (ADL2b) identical
           to dynamin like protein 2b (ADL2b) [Arabidopsis
           thaliana] GI:19032339
          Length = 780

 Score =  120 bits (289), Expect = 8e-28
 Identities = 57/93 (61%), Positives = 73/93 (78%)
 Frame = +1

Query: 259 QIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           +I+ MI  +I+  SCLILAV+PANTDLANSDAL++A   DP G RTIGVITKLD+MD GT
Sbjct: 176 RIRTMILTYIKEPSCLILAVSPANTDLANSDALQIAGNADPDGHRTIGVITKLDIMDRGT 235

Query: 439 DARDVLENKLLPLRRGYIGVVNRCRKTLTVART 537
           DAR+ L  K +PLR GY+GVVNR ++ + + R+
Sbjct: 236 DARNHLLGKTIPLRLGYVGVVNRSQEDILMNRS 268



 Score =  104 bits (250), Expect = 4e-23
 Identities = 45/75 (60%), Positives = 63/75 (84%), Gaps = 1/75 (1%)
 Frame = +2

Query: 32  EYAEFLHCKG-KKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDL 208
           E+ EFLH    ++  DF+E+R EIEAET+RV+G NKG+S +PI L+++SPNVL+++L+DL
Sbjct: 99  EWGEFLHHDPVRRIYDFSEIRREIEAETNRVSGENKGVSDIPIGLKIFSPNVLDISLVDL 158

Query: 209 PGLTKVPIGDQPIDI 253
           PG+TKVP+GDQP DI
Sbjct: 159 PGITKVPVGDQPSDI 173



 Score = 37.1 bits (82), Expect = 0.010
 Identities = 19/35 (54%), Positives = 21/35 (60%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLG 614
           Q+DI   + I  AL AE KFF S P Y  L DRLG
Sbjct: 260 QEDILMNRSIKDALVAEEKFFRSRPVYSGLTDRLG 294


>At3g60190.1 68416.m06724 dynamin-like protein E (DL1E) nearly
           identical to dynamin-like protein E [Arabidopsis
           thaliana] GI:19423872; contains Pfam profiles PF01031:
           Dynamin central region, PF00350: Dynamin family,
           PF02212: Dynamin GTPase effector domain
          Length = 624

 Score =  111 bits (266), Expect = 5e-25
 Identities = 52/75 (69%), Positives = 60/75 (80%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           +G  EYAEFLH   K+FTDF  VR EI+ ETDR+TG NK ISPVPI+L +YSPNV+NLTL
Sbjct: 87  DGTEEYAEFLHLPKKQFTDFALVRREIQDETDRITGKNKQISPVPIHLSIYSPNVVNLTL 146

Query: 200 IDLPGLTKVPIGDQP 244
           IDLPGLTKV +  QP
Sbjct: 147 IDLPGLTKVAVEGQP 161



 Score =  101 bits (243), Expect = 3e-22
 Identities = 44/84 (52%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I+ M+  ++ + +C+ILA++PAN D+A SDA+KLAK+VDP G RT GV+TKLDLMD+G
Sbjct: 166 EDIESMVRTYVDKPNCIILAISPANQDIATSDAIKLAKDVDPTGERTFGVLTKLDLMDKG 225

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A +VLE +   L+  ++G+VNR
Sbjct: 226 TNALEVLEGRSYRLQHPWVGIVNR 249



 Score = 32.7 bits (71), Expect = 0.21
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+  A   ER++F + P Y HLA ++G+
Sbjct: 251 QADINKNVDMMLARRKEREYFDTSPDYGHLASKMGS 286


>At1g14830.1 68414.m01774 dynamin-like protein C (DL1C) nearly
           identical to dynamin-like protein C [Arabidopsis
           thaliana] GI:19569772
          Length = 614

 Score =  108 bits (260), Expect = 3e-24
 Identities = 51/78 (65%), Positives = 59/78 (75%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           +G TEYAEFLH   K+F DF  VR EIE ETDR+TG +K IS +PI L +YSPNV+NLTL
Sbjct: 82  DGTTEYAEFLHAPKKRFADFAAVRKEIEDETDRITGKSKQISNIPIQLSIYSPNVVNLTL 141

Query: 200 IDLPGLTKVPIGDQPIDI 253
           IDLPGLTKV +  QP  I
Sbjct: 142 IDLPGLTKVAVDGQPESI 159



 Score =  104 bits (249), Expect = 6e-23
 Identities = 45/84 (53%), Positives = 64/84 (76%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q I+ M+  ++ + +C+ILA++PAN D+A SDA+KLA+EVDP G RT GV TKLD+MD+G
Sbjct: 161 QDIENMVRSYVEKPNCIILAISPANQDIATSDAIKLAREVDPTGERTFGVATKLDIMDKG 220

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           TD  DVLE +   L+  ++G+VNR
Sbjct: 221 TDCLDVLEGRSYRLQHPWVGIVNR 244



 Score = 36.7 bits (81), Expect = 0.013
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+ R D+ AA   E+++F + P Y HLA R+G+
Sbjct: 246 QADINKRVDMIAARRKEQEYFETSPEYGHLASRMGS 281


>At3g61760.1 68416.m06927 dynamin-like protein B (DL1B) identical to
           dynamin-like protein B [Arabidopsis thaliana]
           GI:27543504; strong similarity to GTP-binding protein
           [Arabidopsis thaliana] GI:807577, phragmoplastin SDL5A
           [Glycine max] GI:1218004; contains Pfam profiles
           PF01031: Dynamin central region, PF00350: Dynamin
           family, PF02212: Dynamin GTPase effector domain
          Length = 610

 Score =  106 bits (254), Expect = 1e-23
 Identities = 47/84 (55%), Positives = 67/84 (79%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           Q I+ M+  FI + +C+ILA++PAN DLA SDA+K+++EVDP+G RT GV+TK+DLMD+G
Sbjct: 160 QDIENMVRSFIEKPNCIILAISPANQDLATSDAIKISREVDPKGDRTFGVLTKIDLMDQG 219

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A D+LE +   LR  ++GVVNR
Sbjct: 220 TNAVDILEGRGYKLRYPWVGVVNR 243



 Score = 98.7 bits (235), Expect = 3e-21
 Identities = 50/80 (62%), Positives = 59/80 (73%), Gaps = 1/80 (1%)
 Frame = +2

Query: 17  INGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTG-SNKGISPVPINLRVYSPNVLNL 193
           I+   EYAEF+H   KKFTDF  VR EI  ETDR TG S+K IS VPI+L ++SPNV+NL
Sbjct: 79  IDEGKEYAEFMHLPKKKFTDFAAVRQEISDETDRETGRSSKVISTVPIHLSIFSPNVVNL 138

Query: 194 TLIDLPGLTKVPIGDQPIDI 253
           TL+DLPGLTKV +  QP  I
Sbjct: 139 TLVDLPGLTKVAVDGQPESI 158



 Score = 37.5 bits (83), Expect = 0.007
 Identities = 16/36 (44%), Positives = 23/36 (63%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+ AA   ER +F + P YRHL +R+G+
Sbjct: 245 QADINKSVDMIAARRRERDYFQTSPEYRHLTERMGS 280


>At2g44590.3 68415.m05551 dynamin-like protein D (DL1D) identical to
           dynamin-like protein D [Arabidopsis thaliana]
           GI:19569770; contains Pfam profiles PF01031: Dynamin
           central region, PF00350: Dynamin family, PF02212:
           Dynamin GTPase effector domain
          Length = 612

 Score =  105 bits (253), Expect = 2e-23
 Identities = 49/75 (65%), Positives = 59/75 (78%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTL 199
           NG  + AEFLH   KKFT+F+ VR EIE ETDR+TG NK IS +PI+L ++SPNV+NLTL
Sbjct: 82  NGTEDNAEFLHLTNKKFTNFSLVRKEIEDETDRITGKNKQISSIPIHLSIFSPNVVNLTL 141

Query: 200 IDLPGLTKVPIGDQP 244
           IDLPGLTKV +  QP
Sbjct: 142 IDLPGLTKVAVEGQP 156



 Score =  102 bits (245), Expect = 2e-22
 Identities = 45/84 (53%), Positives = 65/84 (77%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I+ M+  ++ + +CLILA++PAN D+A SDA+KLAKEVDP G RT GV+TKLDLMD+G
Sbjct: 161 EDIESMVRSYVEKPNCLILAISPANQDIATSDAMKLAKEVDPIGDRTFGVLTKLDLMDKG 220

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A DV+  +   L+  ++G+VNR
Sbjct: 221 TNALDVINGRSYKLKYPWVGIVNR 244



 Score = 34.3 bits (75), Expect = 0.069
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+  A   ER++F + P Y HLA R+G+
Sbjct: 246 QADINKNVDMMVARRKEREYFETSPDYGHLATRMGS 281


>At5g42080.2 68418.m05123 GTP-binding protein / phragmoplastin,
           putative strong similarity to GTP-binding protein
           [Arabidopsis thaliana] GI:807577, phragmoplastin SDL5A
           [Glycine max] GI:1218004; contains Pfam profiles
           PF01031: Dynamin central region, PF00350: Dynamin family
          Length = 429

 Score =  104 bits (250), Expect = 4e-23
 Identities = 50/78 (64%), Positives = 60/78 (76%)
 Frame = +2

Query: 8   RQLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVL 187
           +++ +G  EYAEFLH   KKFTDF  VR EI+ ETDR TG +K IS VPI+L +YSPNV+
Sbjct: 77  QKIDDGTREYAEFLHLPRKKFTDFAAVRKEIQDETDRETGRSKAISSVPIHLSIYSPNVV 136

Query: 188 NLTLIDLPGLTKVPIGDQ 241
           NLTLIDLPGLTKV +  Q
Sbjct: 137 NLTLIDLPGLTKVAVDGQ 154



 Score =  103 bits (246), Expect = 1e-22
 Identities = 44/84 (52%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I+ M+  +I + +C+ILA++PAN DLA SDA+K+++EVDP G RT GV+TK+DLMD+G
Sbjct: 160 KDIENMVRSYIEKPNCIILAISPANQDLATSDAIKISREVDPSGDRTFGVLTKIDLMDKG 219

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           TDA ++LE +   L+  ++GVVNR
Sbjct: 220 TDAVEILEGRSFKLKYPWVGVVNR 243



 Score = 35.1 bits (77), Expect = 0.039
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+ AA   ER++F +   YRHLA+++G+
Sbjct: 245 QADINKNVDMIAARKREREYFSNTTEYRHLANKMGS 280


>At5g42080.1 68418.m05122 GTP-binding protein / phragmoplastin,
           putative strong similarity to GTP-binding protein
           [Arabidopsis thaliana] GI:807577, phragmoplastin SDL5A
           [Glycine max] GI:1218004; contains Pfam profiles
           PF01031: Dynamin central region, PF00350: Dynamin family
          Length = 610

 Score =  104 bits (250), Expect = 4e-23
 Identities = 50/78 (64%), Positives = 60/78 (76%)
 Frame = +2

Query: 8   RQLINGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVL 187
           +++ +G  EYAEFLH   KKFTDF  VR EI+ ETDR TG +K IS VPI+L +YSPNV+
Sbjct: 77  QKIDDGTREYAEFLHLPRKKFTDFAAVRKEIQDETDRETGRSKAISSVPIHLSIYSPNVV 136

Query: 188 NLTLIDLPGLTKVPIGDQ 241
           NLTLIDLPGLTKV +  Q
Sbjct: 137 NLTLIDLPGLTKVAVDGQ 154



 Score =  103 bits (246), Expect = 1e-22
 Identities = 44/84 (52%), Positives = 66/84 (78%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I+ M+  +I + +C+ILA++PAN DLA SDA+K+++EVDP G RT GV+TK+DLMD+G
Sbjct: 160 KDIENMVRSYIEKPNCIILAISPANQDLATSDAIKISREVDPSGDRTFGVLTKIDLMDKG 219

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           TDA ++LE +   L+  ++GVVNR
Sbjct: 220 TDAVEILEGRSFKLKYPWVGVVNR 243



 Score = 35.1 bits (77), Expect = 0.039
 Identities = 15/36 (41%), Positives = 24/36 (66%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+ AA   ER++F +   YRHLA+++G+
Sbjct: 245 QADINKNVDMIAARKREREYFSNTTEYRHLANKMGS 280


>At2g44590.2 68415.m05550 dynamin-like protein D (DL1D) identical to
           dynamin-like protein D [Arabidopsis thaliana]
           GI:19569770; contains Pfam profiles PF01031: Dynamin
           central region, PF00350: Dynamin family, PF02212:
           Dynamin GTPase effector domain
          Length = 595

 Score =  102 bits (245), Expect = 2e-22
 Identities = 45/84 (53%), Positives = 65/84 (77%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I+ M+  ++ + +CLILA++PAN D+A SDA+KLAKEVDP G RT GV+TKLDLMD+G
Sbjct: 144 EDIESMVRSYVEKPNCLILAISPANQDIATSDAMKLAKEVDPIGDRTFGVLTKLDLMDKG 203

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A DV+  +   L+  ++G+VNR
Sbjct: 204 TNALDVINGRSYKLKYPWVGIVNR 227



 Score = 73.7 bits (173), Expect = 9e-14
 Identities = 33/54 (61%), Positives = 41/54 (75%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPN 181
           NG  + AEFLH   KKFT+F+ VR EIE ETDR+TG NK IS +PI+L ++SPN
Sbjct: 82  NGTEDNAEFLHLTNKKFTNFSLVRKEIEDETDRITGKNKQISSIPIHLSIFSPN 135



 Score = 34.3 bits (75), Expect = 0.069
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+  A   ER++F + P Y HLA R+G+
Sbjct: 229 QADINKNVDMMVARRKEREYFETSPDYGHLATRMGS 264


>At2g44590.1 68415.m05549 dynamin-like protein D (DL1D) identical to
           dynamin-like protein D [Arabidopsis thaliana]
           GI:19569770; contains Pfam profiles PF01031: Dynamin
           central region, PF00350: Dynamin family, PF02212:
           Dynamin GTPase effector domain
          Length = 596

 Score =  102 bits (245), Expect = 2e-22
 Identities = 45/84 (53%), Positives = 65/84 (77%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           + I+ M+  ++ + +CLILA++PAN D+A SDA+KLAKEVDP G RT GV+TKLDLMD+G
Sbjct: 144 EDIESMVRSYVEKPNCLILAISPANQDIATSDAMKLAKEVDPIGDRTFGVLTKLDLMDKG 203

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
           T+A DV+  +   L+  ++G+VNR
Sbjct: 204 TNALDVINGRSYKLKYPWVGIVNR 227



 Score = 73.7 bits (173), Expect = 9e-14
 Identities = 33/54 (61%), Positives = 41/54 (75%)
 Frame = +2

Query: 20  NGNTEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPN 181
           NG  + AEFLH   KKFT+F+ VR EIE ETDR+TG NK IS +PI+L ++SPN
Sbjct: 82  NGTEDNAEFLHLTNKKFTNFSLVRKEIEDETDRITGKNKQISSIPIHLSIFSPN 135



 Score = 34.3 bits (75), Expect = 0.069
 Identities = 15/36 (41%), Positives = 22/36 (61%)
 Frame = +3

Query: 510 QKDIDGRKDIAAALAAERKFFLSHPSYRHLADRLGT 617
           Q DI+   D+  A   ER++F + P Y HLA R+G+
Sbjct: 229 QADINKNVDMMVARRKEREYFETSPDYGHLATRMGS 264


>At1g60500.1 68414.m06811 dynamin family protein similar to RBTMx2
           [Oncorhynchus mykiss] GI:1399452; contains Pfam profiles
           PF01031: Dynamin central region, PF00350: Dynamin
           family, PF02212: Dynamin GTPase effector domain
          Length = 669

 Score = 60.9 bits (141), Expect = 7e-10
 Identities = 27/61 (44%), Positives = 38/61 (62%)
 Frame = +2

Query: 71  TDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPID 250
           TD   +   I A TD + GS KG+S  P+ L V    V +LT++DLPG+T+VP+  QP +
Sbjct: 127 TDEEHIAEAIRAATDVIAGSGKGVSDAPLTLHVKKAGVPDLTMVDLPGITRVPVNGQPEN 186

Query: 251 I 253
           I
Sbjct: 187 I 187



 Score = 56.4 bits (130), Expect = 1e-08
 Identities = 28/84 (33%), Positives = 49/84 (58%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI GMI ++I  +  +IL V  A  D    ++++++++VD  G RT+ V+TK D+  EG
Sbjct: 189 EQISGMIMEYIEPQESIILNVLSATVDFTTCESIRMSRKVDKTGQRTLAVVTKADMAPEG 248

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
              +   ++  + L  GY+ V NR
Sbjct: 249 LLQKVTADDVSIVL--GYVCVRNR 270


>At1g60540.1 68414.m06815 dynamin family protein similar to
           SP|Q91192 Interferon-induced GTP-binding protein Mx
           {Oncorhynchus mykiss}; contains Pfam profiles PF01031:
           Dynamin central region, PF00350: Dynamin family,
           PF02212: Dynamin GTPase effector domain
          Length = 648

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 26/61 (42%), Positives = 38/61 (62%)
 Frame = +2

Query: 71  TDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPID 250
           TD   +   I A TD + GS KG+S  P+ L V    V ++T++DLPG+T+VP+  QP +
Sbjct: 128 TDEEHIAQTICAATDVIAGSGKGVSDTPLTLHVKKAGVPDITMVDLPGITRVPVNGQPEN 187

Query: 251 I 253
           I
Sbjct: 188 I 188



 Score = 53.6 bits (123), Expect = 1e-07
 Identities = 27/84 (32%), Positives = 48/84 (57%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI  M+ ++I  +  +IL V  A  D    ++++++K+VD  G RT+ V+TK D+  EG
Sbjct: 190 EQISRMVMKYIEPQESIILNVLSATVDFTTCESIRMSKQVDKTGERTLAVVTKADMAPEG 249

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
              +   ++  + L  GY+ V NR
Sbjct: 250 LLQKVTADDVSIGL--GYVCVRNR 271


>At1g60530.1 68414.m06814 dynamin family protein similar to mx2
           protein GI:5578742 from [Mus musculus musculus];
           contains Pfam profile PF00350: Dynamin family
          Length = 301

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 27/61 (44%), Positives = 39/61 (63%)
 Frame = +2

Query: 71  TDFNEVRGEIEAETDRVTGSNKGISPVPINLRVYSPNVLNLTLIDLPGLTKVPIGDQPID 250
           TD   V   I A TD + G+ +G+S  P+ L V   NV +LT++DLPG+T+VP+  QP +
Sbjct: 124 TDEEHVAEAICAATDVIAGTGEGVSDTPLTLSVKKNNVPDLTMVDLPGITRVPVNGQPEN 183

Query: 251 I 253
           I
Sbjct: 184 I 184



 Score = 53.2 bits (122), Expect = 1e-07
 Identities = 28/84 (33%), Positives = 48/84 (57%)
 Frame = +1

Query: 256 QQIKGMIFQFIRRESCLILAVTPANTDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEG 435
           +QI  MI ++I  +  +IL V  A  D    ++++++++VD  G RT+ V+TK D+  EG
Sbjct: 186 EQISRMIMKYIEPQESIILNVLSATVDFTTCESIRMSRQVDKTGERTLAVVTKADMAPEG 245

Query: 436 TDARDVLENKLLPLRRGYIGVVNR 507
              +   ++  + L  GYI V NR
Sbjct: 246 LLQKVTADDVSIGL--GYICVRNR 267


>At1g10290.1 68414.m01159 dynamin-like protein 6 (ADL6) identical to
           dynamin-like protein 6 (ADL6) [Arabidopsis thaliana]
           GI:6651399; contains Pfam profiles PF01031: Dynamin
           central region, PF00350: Dynamin family, PF02212:
           Dynamin GTPase effector domain, PF00169: PH domain
          Length = 914

 Score = 50.8 bits (116), Expect = 7e-07
 Identities = 23/62 (37%), Positives = 41/62 (66%), Gaps = 2/62 (3%)
 Frame = +1

Query: 265 KGMIFQFIRRESCLILAVTPAN--TDLANSDALKLAKEVDPQGLRTIGVITKLDLMDEGT 438
           + MI ++ +    ++L + PA+  +++++S ALK+AKE DP+  RTIG+I K+D   E +
Sbjct: 154 ESMIAEYAQHNDAILLVIVPASQASEISSSRALKIAKEYDPESTRTIGIIGKIDQAAENS 213

Query: 439 DA 444
            A
Sbjct: 214 KA 215


>At1g59610.1 68414.m06704 dynamin-like protein, putative (ADL3)
           strong similarity to dynamin-like protein 6 (ADL6)
           [Arabidopsis thaliana] GI:6651399; contains Pfam
           profiles PF01031: Dynamin central region, PF00350:
           Dynamin family, PF02212: Dynamin GTPase effector domain,
           PF00169: PH domain; identical to cDNA dynamin-like
           protein ADL3,  GI:4803835
          Length = 920

 Score = 48.0 bits (109), Expect = 5e-06
 Identities = 21/52 (40%), Positives = 37/52 (71%), Gaps = 2/52 (3%)
 Frame = +1

Query: 271 MIFQFIRRESCLILAVTPAN--TDLANSDALKLAKEVDPQGLRTIGVITKLD 420
           MI +  +    ++L V PA+  +++++S ALK+AKE DP+  RT+G+I+K+D
Sbjct: 156 MIGEHAQHNDAILLVVVPASQASEISSSRALKIAKEYDPESTRTVGIISKID 207


>At5g37890.1 68418.m04565 seven in absentia (SINA) protein, putative
           similar to SIAH1 protein [Brassica napus var. napus]
           GI:7657876; contains Pfam profile PF03145: Seven in
           absentia protein family
          Length = 286

 Score = 32.3 bits (70), Expect = 0.28
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = -3

Query: 144 DIPLLEPVTRSVSASISPRTSLKSVNFFPLQCKNSAYSVFPFISCLVP 1
           DIPL   V  ++S  I  RT   + + F +QC    Y V+  +SC+ P
Sbjct: 173 DIPL--SVRMNISKKILIRTEHLTNHLFAVQCFREPYGVYVTVSCIAP 218


>At1g53140.1 68414.m06017 dynamin family protein low similarity to
           dynamin-like protein E [Arabidopsis thaliana]
           GI:19423872; contains Pfam profile PF00350: Dynamin
           family
          Length = 817

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%)
 Frame = +2

Query: 59  GKKFTDFNEVRGEIEAETDRVTGSNK-GISPVPINLRVYSPNVLNLTLIDLPG 214
           G        V   I + T+ +    K  +SP PI +R    +  NLT+ID PG
Sbjct: 126 GSPIVSATAVADVIRSRTEALLKKTKTAVSPKPIVMRAEYAHCPNLTIIDTPG 178


>At5g07830.1 68418.m00898 glycosyl hydrolase family 79 N-terminal
           domain-containing protein similar to beta-glucuronidase
           GI:8918740 from [Scutellaria baicalensis]
          Length = 543

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = -3

Query: 150 TGDIPLLEPVTRSVSASIS 94
           TGDIP LEPV RSV++ ++
Sbjct: 505 TGDIPSLEPVLRSVNSPLN 523


>At1g28260.2 68414.m03469 expressed protein
          Length = 880

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = -3

Query: 411 CYYADSTQSLWVYFFGKLQSIAVGQIRVGRSNCQDK 304
           C + + ++S   YFFGKL  I + Q++V   NC  K
Sbjct: 416 CRFDEKSKSAISYFFGKLVDI-LNQLKVKDKNCPAK 450


>At1g28260.1 68414.m03468 expressed protein
          Length = 880

 Score = 29.1 bits (62), Expect = 2.6
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = -3

Query: 411 CYYADSTQSLWVYFFGKLQSIAVGQIRVGRSNCQDK 304
           C + + ++S   YFFGKL  I + Q++V   NC  K
Sbjct: 416 CRFDEKSKSAISYFFGKLVDI-LNQLKVKDKNCPAK 450


>At1g76170.1 68414.m08845 expressed protein  contains Pfam profile
           PF01171: PP-loop family
          Length = 299

 Score = 27.9 bits (59), Expect = 6.0
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +1

Query: 382 QGLRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRCRKTLT 525
           Q L     + K+D +  G +A D+ E  +L + RG I  ++RC    T
Sbjct: 130 QALDRGAALLKVDKLVTGHNADDIAETVVLNILRGDIARLSRCTSITT 177


>At1g54380.1 68414.m06200 spliceosome protein-related contains Pfam
           domain, PF04938: Survival motor neuron (SMN) interacting
           protein 1 (SIP1)
          Length = 515

 Score = 27.5 bits (58), Expect = 7.9
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = +2

Query: 29  TEYAEFLHCKGKKFTDFNEVRGEIEAETDRVTGSNKG 139
           TEY   ++ K  K +  N VRG  E+  +   G+ +G
Sbjct: 232 TEYESLVYVKNYKSSKSNRVRGRTESGNEENLGTEEG 268


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,312,130
Number of Sequences: 28952
Number of extensions: 262141
Number of successful extensions: 708
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 666
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 707
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1305036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -