SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20060
         (530 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Simi...    98   3e-21
At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Simi...    98   3e-21
At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60...    97   9e-21
At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) simi...    97   9e-21
At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138...    36   0.017
At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative...    29   1.5  
At4g24350.1 68417.m03494 phosphorylase family protein contains P...    29   2.0  
At5g25320.1 68418.m03004 ACT domain-containing protein contains ...    28   3.4  
At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transfera...    28   3.4  
At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa...    28   3.4  
At2g13150.1 68415.m01450 expressed protein contains a bZIP trans...    28   3.4  
At5g41220.1 68418.m05009 glutathione S-transferase, putative sim...    27   6.0  
At4g31490.1 68417.m04473 coatomer beta subunit, putative / beta-...    27   6.0  
At3g45880.1 68416.m04965 hypothetical protein                          27   6.0  
At5g41240.1 68418.m05011 glutathione S-transferase, putative sim...    27   7.9  
At1g76990.3 68414.m08966 ACT domain containing protein low simil...    27   7.9  
At1g76990.2 68414.m08965 ACT domain containing protein low simil...    27   7.9  
At1g76990.1 68414.m08964 ACT domain containing protein low simil...    27   7.9  

>At1g09690.1 68414.m01088 60S ribosomal protein L21 (RPL21C) Similar
           to ribosomal protein L21 (gb|L38826). ESTs
           gb|AA395597,gb|ATTS5197 come from this gene
          Length = 164

 Score = 98.3 bits (234), Expect = 3e-21
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (0%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G+  R + L    FR  G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++
Sbjct: 6   GVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIW 65

Query: 219 NVTAHALGVIVNSVFAEGLYRS-ASISVLSMSSTPSADKTSLRESK 353
           NVT  A+GV VN      + R    + V  +  +  A++  LR+ K
Sbjct: 66  NVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKK 111



 Score = 75.8 bits (178), Expect = 2e-14
 Identities = 36/84 (42%), Positives = 54/84 (64%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAP 424
           +  +++  RII KRI++RVEHV+ S+C ++F  R K+N+ L   AKA G+T++ KRQP  
Sbjct: 75  EVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKG 134

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFV 496
           PK   +V G      + PIPY+ V
Sbjct: 135 PKPGFMVEGMTLET-VTPIPYDVV 157


>At1g09590.1 68414.m01076 60S ribosomal protein L21 (RPL21A) Similar
           to L21 family of ribosomal protein; amino acid sequence
           is identical to F21M12.8
          Length = 164

 Score = 98.3 bits (234), Expect = 3e-21
 Identities = 47/106 (44%), Positives = 66/106 (62%), Gaps = 1/106 (0%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G+  R + L    FR  G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++
Sbjct: 6   GVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIW 65

Query: 219 NVTAHALGVIVNSVFAEGLYRS-ASISVLSMSSTPSADKTSLRESK 353
           NVT  A+GV VN      + R    + V  +  +  A++  LR+ K
Sbjct: 66  NVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKK 111



 Score = 75.8 bits (178), Expect = 2e-14
 Identities = 36/84 (42%), Positives = 54/84 (64%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAP 424
           +  +++  RII KRI++RVEHV+ S+C ++F  R K+N+ L   AKA G+T++ KRQP  
Sbjct: 75  EVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKG 134

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFV 496
           PK   +V G      + PIPY+ V
Sbjct: 135 PKPGFMVEGMTLET-VTPIPYDVV 157


>At1g57860.1 68414.m06565 60S ribosomal protein L21 similar to 60S
           ribosomal protein L21 GI:3885884 from [Oryza sativa]
          Length = 164

 Score = 96.7 bits (230), Expect = 9e-21
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 1/106 (0%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G+  R + L    FR  G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++
Sbjct: 6   GVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIW 65

Query: 219 NVTAHALGVIVNSVFAEGLYRS-ASISVLSMSSTPSADKTSLRESK 353
           NVT  A+GV VN      + R    + V  +  +  A++  LR+ +
Sbjct: 66  NVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQ 111



 Score = 76.6 bits (180), Expect = 1e-14
 Identities = 36/84 (42%), Positives = 55/84 (65%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAP 424
           +  +++  RII KRI++RVEHV+ S+C ++F  R K+N+ L  +AKA G+T++ KRQP  
Sbjct: 75  EVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKG 134

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFV 496
           PK   +V G      + PIPY+ V
Sbjct: 135 PKPGFMVEGMTLET-VTPIPYDVV 157


>At1g57660.1 68414.m06543 60S ribosomal protein L21 (RPL21E) similar
           to 60S ribosomal protein L21 GB:Q43291 GI:2851508 from
           [Arabidopsis thaliana]
          Length = 164

 Score = 96.7 bits (230), Expect = 9e-21
 Identities = 46/106 (43%), Positives = 66/106 (62%), Gaps = 1/106 (0%)
 Frame = +3

Query: 39  GLPXRHQGLVRSQFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVY 218
           G+  R + L    FR  G IPLSTY++ +KVGD VD++ NGA+ KGMPHK YHG+TGR++
Sbjct: 6   GVRARTRDLFARPFRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIW 65

Query: 219 NVTAHALGVIVNSVFAEGLYRS-ASISVLSMSSTPSADKTSLRESK 353
           NVT  A+GV VN      + R    + V  +  +  A++  LR+ +
Sbjct: 66  NVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQ 111



 Score = 76.6 bits (180), Expect = 1e-14
 Identities = 36/84 (42%), Positives = 55/84 (65%)
 Frame = +2

Query: 245 DCQQRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAP 424
           +  +++  RII KRI++RVEHV+ S+C ++F  R K+N+ L  +AKA G+T++ KRQP  
Sbjct: 75  EVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKG 134

Query: 425 PKAAHIVSGTEKPVLLAPIPYEFV 496
           PK   +V G      + PIPY+ V
Sbjct: 135 PKPGFMVEGMTLET-VTPIPYDVV 157


>At1g62330.1 68414.m07033 expressed protein contains Pfam PF03138:
           Plant protein family. The function of this family of
           plant proteins is unknown;
          Length = 672

 Score = 35.9 bits (79), Expect = 0.017
 Identities = 22/65 (33%), Positives = 30/65 (46%)
 Frame = +3

Query: 174 GMPHKVYHGKTGRVYNVTAHALGVIVNSVFAEGLYRSASISVLSMSSTPSADKTSLRESK 353
           G P K Y+G  GR+    AHAL    N +  + L+R      L+    P AD+ S + S 
Sbjct: 182 GKPKKTYNGTYGRLLAYAAHALAEGQNKLEPKELWREPKDQALAWK--PCADQRSWKPSD 239

Query: 354 RMRGY 368
              GY
Sbjct: 240 GKNGY 244


>At1g20020.1 68414.m02507 ferredoxin--NADP(+) reductase, putative /
           adrenodoxin reductase, putative strong similarity to
           Ferredoxin--NADP reductase, chloroplast precursor (EC
           1.18.1.2) (FNR) from {Pisum sativum} SP|P10933,
           {Mesembryanthemum crystallinum} SP|P41343, {Spinacia
           oleracea} SP|P00455, [Capsicum annuum] GI:6899972
          Length = 369

 Score = 29.5 bits (63), Expect = 1.5
 Identities = 16/45 (35%), Positives = 25/45 (55%)
 Frame = +3

Query: 123 YKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNS 257
           Y+ G  V +  +G  + G PHKV      R+Y++ + ALG + NS
Sbjct: 125 YREGQSVGVIADGIDKNGKPHKV------RLYSIASSALGDLGNS 163


>At4g24350.1 68417.m03494 phosphorylase family protein contains Pfam
           PF01048: Phosphorylase family
          Length = 336

 Score = 29.1 bits (62), Expect = 2.0
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = -1

Query: 149 DVYNVSNFVHFHVRGERNSSM 87
           DV+NV   VHF + G  N+SM
Sbjct: 114 DVFNVKGIVHFGIAGNMNNSM 134


>At5g25320.1 68418.m03004 ACT domain-containing protein contains
           Pfam ACT domain PF01842
          Length = 500

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +2

Query: 161 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 253
           C  +GY+  ++  KDR R+  D  C+  D Q
Sbjct: 291 CEERGYSIVTVKSKDRRRLMFDTICTLVDMQ 321


>At5g05900.1 68418.m00651 UDP-glucoronosyl/UDP-glucosyl transferase
           family protein contains Pfam profile: PF00201
           UDP-glucoronosyl and UDP-glucosyl transferase
          Length = 450

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 15/31 (48%), Positives = 17/31 (54%)
 Frame = -1

Query: 188 FVWHTLLNCTIASDVYNVSNFVHFHVRGERN 96
           FVW  LLN    SDV+ V   +H   R ERN
Sbjct: 369 FVWDQLLNARFVSDVWMVG--LHLEGRIERN 397


>At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family
            protein belongs to Pfam:PF03372:
            Endonuclease/Exonuclease/phosphatase family; contains 3
            WD-40 repeats (PF00400);similar to Type II
            inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56
            (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens]
          Length = 1305

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 10/28 (35%), Positives = 20/28 (71%)
 Frame = +2

Query: 284  RINIRVEHVKHSKCRQDFLKRVKENERL 367
            + ++++EHV  S  RQ+F + +K NE++
Sbjct: 920  KFHVKIEHVDRSVRRQEFGRIIKTNEKV 947


>At2g13150.1 68415.m01450 expressed protein contains a bZIP
           transcription factor basic domain signature (PDOC00036)
          Length = 262

 Score = 28.3 bits (60), Expect = 3.4
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +3

Query: 303 SMSSTPSADKTSLRESKRMRGY*RKPRLPARPST*RDSQLPLKLPTSSVELRNPS 467
           S +STPS  ++  + S         P L   PS+ R + +PL  P++SVE R+ S
Sbjct: 4   SDNSTPSRPRSITQPSLAFSSL---PPLSPSPSSSRRNSIPLMNPSASVESRDSS 55


>At5g41220.1 68418.m05009 glutathione S-transferase, putative
           similar to emb|CAA10662
          Length = 590

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +2

Query: 83  HTWNYSALHVHESVQSWRHCRHQRQWCS 166
           +T NY +    E   +WR  RH ++WCS
Sbjct: 370 YTNNYKSNFTLE--HAWRELRHSKKWCS 395


>At4g31490.1 68417.m04473 coatomer beta subunit, putative /
           beta-coat protein, putative / beta-COP, putative similar
           to Coatomer beta subunit (Beta-coat protein) (Beta-COP)
           from {Rattus norvegicus} SP|P23514, {Mus musculus}
           SP|Q9JIF7, {Homo sapiens} SP|P53618; contains Pfam
           profile: PF01602 Adaptin N terminal region
          Length = 948

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
 Frame = +2

Query: 290 NIRVEHVKHSKCRQDFLKRVKENE-RLLKEAKAAGKTVN 403
           N+ ++ +    CRQ F+K + E + R ++E KA  +T +
Sbjct: 628 NVEMKKIWLESCRQSFVKMISEKQLREMEELKAKTQTTH 666


>At3g45880.1 68416.m04965 hypothetical protein
          Length = 431

 Score = 27.5 bits (58), Expect = 6.0
 Identities = 18/55 (32%), Positives = 24/55 (43%)
 Frame = -2

Query: 418 WLSLQVDGLAGSLGFLQ*PLILFDSLKEVLSALGVLDMLNTDIDALRYNPSANTL 254
           W  +Q D       FLQ  L    SL  VLS     D  ++D +  ++ PSA  L
Sbjct: 299 WYDMQFDIKYAYFNFLQSLLYKSSSLNPVLSWREDEDSESSDAEGSKFTPSATNL 353


>At5g41240.1 68418.m05011 glutathione S-transferase, putative
           similar to glutathione S-transferase, GST 10b
           GB:CAA10662 [Arabidopsis thaliana] 37349.
          Length = 591

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = +2

Query: 128 SWRHCRHQRQWCSS 169
           +WR  RH ++WCS+
Sbjct: 385 AWRELRHNKKWCST 398


>At1g76990.3 68414.m08966 ACT domain containing protein low
           similarity to uridylyltransferase SP|P56884 from
           Rhizobium meliloti; contains Pfam ACT domain PF01842
          Length = 453

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +2

Query: 161 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 253
           C  KGY+  ++  +DR ++  D  C+  D Q
Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289


>At1g76990.2 68414.m08965 ACT domain containing protein low
           similarity to uridylyltransferase SP|P56884 from
           Rhizobium meliloti; contains Pfam ACT domain PF01842
          Length = 453

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +2

Query: 161 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 253
           C  KGY+  ++  +DR ++  D  C+  D Q
Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289


>At1g76990.1 68414.m08964 ACT domain containing protein low
           similarity to uridylyltransferase SP|P56884 from
           Rhizobium meliloti; contains Pfam ACT domain PF01842
          Length = 453

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +2

Query: 161 CSSKGYATQSIPWKDRSRVQRDCSCSRCDCQ 253
           C  KGY+  ++  +DR ++  D  C+  D Q
Sbjct: 259 CEEKGYSVINVSCEDRPKLMFDIVCTLTDMQ 289


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,464,546
Number of Sequences: 28952
Number of extensions: 233283
Number of successful extensions: 719
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 703
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 719
length of database: 12,070,560
effective HSP length: 76
effective length of database: 9,870,208
effective search space used: 987020800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -