SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20058
         (614 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g13260.1 68417.m02075 flavin-containing monooxygenase / FMO (...    29   1.9  
At2g17140.1 68415.m01979 pentatricopeptide (PPR) repeat-containi...    28   4.3  
At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR...    27   7.5  
At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutas...    27   7.5  

>At4g13260.1 68417.m02075 flavin-containing monooxygenase / FMO
           (YUCCA2) identical to gi:16555354
          Length = 415

 Score = 29.5 bits (63), Expect = 1.9
 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = -3

Query: 609 RLLSSNSPLM*GRAP*R-SKAAILKVTSWPSLTLDRSTCLQAL 484
           R L    P++ G  P   + AA LK    PSL L+RSTC+ +L
Sbjct: 21  RCLMIPGPIIVGSGPSGLATAACLKSRDIPSLILERSTCIASL 63


>At2g17140.1 68415.m01979 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 903

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 1/68 (1%)
 Frame = +1

Query: 49  HGYLTIWKLIIMSKIIKFDLRELKQLANDKNSCLVVKKI-TQNLALQPWCLGNIKESITN 225
           H  L  +  +I+   IK  + E+  L ++     +   I T N A+Q  C G   E  TN
Sbjct: 591 HKSLETYNSLILGLGIKNQIFEIHGLMDEMKEKGISPNICTYNTAIQYLCEGEKVEDATN 650

Query: 226 LLDYKVGK 249
           LLD  + K
Sbjct: 651 LLDEMMQK 658


>At4g36140.1 68417.m05144 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1607

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +1

Query: 142 SCLVVKKITQNLALQPWCLGNIKE 213
           S +V+  +++N AL PWCL  + E
Sbjct: 103 SRIVIVVLSRNYALSPWCLDELVE 126


>At3g48730.1 68416.m05321 glutamate-1-semialdehyde 2,1-aminomutase 2
           (GSA 2) / glutamate-1-semialdehyde aminotransferase 2
           (GSA-AT 2) identical to GSA2 [SP|Q42522]
          Length = 472

 Score = 27.5 bits (58), Expect = 7.5
 Identities = 8/23 (34%), Positives = 16/23 (69%)
 Frame = -1

Query: 158 FTTKQEFLSFANCFNSRRSNFMI 90
           FT KQ+F+ F  C++   ++F++
Sbjct: 176 FTGKQKFIKFEGCYHGHANSFLV 198


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,107,736
Number of Sequences: 28952
Number of extensions: 230528
Number of successful extensions: 404
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 399
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 404
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1236350304
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -