SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20057
         (573 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g30780.1 68415.m03753 pentatricopeptide (PPR) repeat-containi...    31   0.41 
At5g65910.1 68418.m08296 BSD domain-containing protein contains ...    31   0.55 
At5g60800.1 68418.m07628 heavy-metal-associated domain-containin...    31   0.55 
At3g61390.2 68416.m06872 U-box domain-containing protein several...    31   0.55 
At3g43920.1 68416.m04701 ribonuclease III family protein similar...    31   0.55 
At1g12380.1 68414.m01431 expressed protein                             30   0.95 
At1g11670.1 68414.m01340 MATE efflux family protein similar to r...    30   0.95 
At5g29624.1 68418.m03640 DC1 domain-containing protein contains ...    29   1.7  
At4g01735.1 68417.m00225 expressed protein ; expression supporte...    29   1.7  
At1g33060.2 68414.m04076 no apical meristem (NAM) family protein...    29   1.7  
At1g33060.1 68414.m04075 no apical meristem (NAM) family protein...    29   1.7  
At5g54050.1 68418.m06722 DC1 domain-containing protein                 29   2.2  
At1g27850.1 68414.m03413 expressed protein similar to En/Spm-lik...    29   2.2  
At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL) ide...    29   2.9  
At2g23950.1 68415.m02860 leucine-rich repeat family protein / pr...    29   2.9  
At1g51070.1 68414.m05741 basic helix-loop-helix (bHLH) family pr...    28   3.8  
At5g54030.1 68418.m06720 DC1 domain-containing protein contains ...    27   6.7  
At4g09010.1 68417.m01488 L-ascorbate peroxidase, chloroplast, pu...    27   6.7  
At3g54670.1 68416.m06049 structural maintenance of chromosomes (...    27   6.7  
At3g15920.1 68416.m02013 phox (PX) domain-containing protein wea...    27   6.7  
At5g54040.1 68418.m06721 DC1 domain-containing protein contains ...    27   8.9  
At3g54220.1 68416.m05993 scarecrow transcription factor, putativ...    27   8.9  
At3g28600.1 68416.m03570 AAA-type ATPase family protein contains...    27   8.9  
At3g24440.1 68416.m03067 fibronectin type III domain-containing ...    27   8.9  
At3g06720.2 68416.m00797 importin alpha-1 subunit, putative (IMP...    27   8.9  
At3g06720.1 68416.m00796 importin alpha-1 subunit, putative (IMP...    27   8.9  
At2g36890.1 68415.m04524 myb family transcription factor (MYB38)...    27   8.9  
At1g26580.1 68414.m03238 expressed protein similar to putative M...    27   8.9  

>At2g30780.1 68415.m03753 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 452

 Score = 31.5 bits (68), Expect = 0.41
 Identities = 17/46 (36%), Positives = 26/46 (56%)
 Frame = +3

Query: 360 TQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWYART 497
           T  P HH D  + VS +K+++ T   + ++ FQ V D  G+W  RT
Sbjct: 20  TSLPAHHTDLVQRVSILKDELLTIGNS-KEKFQNVLDQKGQWLFRT 64


>At5g65910.1 68418.m08296 BSD domain-containing protein contains
           Pfam profile PF03909: BSD domain
          Length = 432

 Score = 31.1 bits (67), Expect = 0.55
 Identities = 13/52 (25%), Positives = 23/52 (44%)
 Frame = +3

Query: 321 LRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGI 476
           L  P      +   Q P+H E+ E +++ +KND        R G  ++S  +
Sbjct: 64  LSQPSSSPDLQERNQTPDHPEEDEDLIAGIKNDFAEIGGRFRTGISKLSGNL 115


>At5g60800.1 68418.m07628 heavy-metal-associated domain-containing
           protein similar to farnesylated protein ATFP3
           [GI:4097547]; contains Pfam profile PF00403:
           Heavy-metal-associated domain
          Length = 283

 Score = 31.1 bits (67), Expect = 0.55
 Identities = 19/58 (32%), Positives = 32/58 (55%)
 Frame = +3

Query: 252 VKSDLENVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDIN 425
           V   L+ V++ ++ EE  +  VDL +P P + +E E +N ++ ED +K     K D N
Sbjct: 67  VTGALDPVKLREKLEEKTKKKVDLVSPQPKKEKEKENKN-KNDEDKKKSEEKKKPDNN 123


>At3g61390.2 68416.m06872 U-box domain-containing protein several
           hypothetical proteins - Arabidopsis thaliana
          Length = 435

 Score = 31.1 bits (67), Expect = 0.55
 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +3

Query: 279 VPDENEEIKRPLVDLRN-PGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGF 455
           + +E EE+K  L ++    G  + +E  T N  H E  +  +  + +DI         GF
Sbjct: 319 IREEQEELKIKLREVSKLKGKREEEEASTSN--HREPPQYFICPITHDIMEDPHVAADGF 376

Query: 456 QEVSDGIGKWYAR 494
               + I +W+ R
Sbjct: 377 TYEGEAISRWFER 389


>At3g43920.1 68416.m04701 ribonuclease III family protein similar to
            RNA helicase/RNAseIII CAF protein [Arabidopsis thaliana]
            GI:6102610; contains Pfam profiles PF02170: PAZ domain,
            PF00636: RNase3 domain
          Length = 1531

 Score = 31.1 bits (67), Expect = 0.55
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +1

Query: 454  SRKCQTVLENGTLVPSKLRAPGQLATFP 537
            SRK Q  + NG   P +  APGQ + FP
Sbjct: 1022 SRKLQGYIRNGAFEPRRWTAPGQFSLFP 1049


>At1g12380.1 68414.m01431 expressed protein
          Length = 793

 Score = 30.3 bits (65), Expect = 0.95
 Identities = 18/71 (25%), Positives = 36/71 (50%)
 Frame = +3

Query: 309 PLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQGFQEVSDGIGKWY 488
           PL  +R+         +  +PE  +D +K+++ + +  + A IAL +  +  ++G+   Y
Sbjct: 609 PLYLIRDSSGKYLPPFKCLSPEQEKDVDKLITRLVSR-DEAHIALMELMKWRTEGLDPMY 667

Query: 489 ARTEQIKSSRP 521
           AR  Q+K   P
Sbjct: 668 ARAVQMKERDP 678


>At1g11670.1 68414.m01340 MATE efflux family protein similar to
           ripening regulated protein DDTFR18 [Lycopersicon
           esculentum] GI:12231296; contains Pfam profile PF01554:
           Uncharacterized membrane protein family; EST gb|W43487
           comes from this gene
          Length = 503

 Score = 30.3 bits (65), Expect = 0.95
 Identities = 23/60 (38%), Positives = 29/60 (48%)
 Frame = -2

Query: 218 GMSMTSFLFARRLLSMSLMVLAWSMSSCSLDKLSTTFKGLSSASGTLSGMAGCACGEHEY 39
           GMSM + +FA RL SM L   +   S  ++  L     G+ SA  TL G A    G H Y
Sbjct: 70  GMSMLTRIFAGRLGSMQLAAASLGNSGFNMFTLGLML-GMGSAVETLCGQAH---GAHRY 125


>At5g29624.1 68418.m03640 DC1 domain-containing protein contains
           Pfam PF03107: DC1 domain
          Length = 488

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 16/33 (48%), Positives = 18/33 (54%)
 Frame = +3

Query: 261 DLENVEVPDENEEIKRPLVDLRNPGPPQHQEHE 359
           DLE  +VPDE EEIK P   +   G   H  HE
Sbjct: 261 DLE--DVPDEEEEIKDPFKVINENGDIVHISHE 291


>At4g01735.1 68417.m00225 expressed protein ; expression supported
           by MPSS
          Length = 186

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +1

Query: 40  YSCSPHAQPAIPDKVPEAEDKPLNVVDNLSSEQELIDQAN 159
           + C P+ Q      VP    +  NVV NL+S+Q+L +Q N
Sbjct: 91  HCCQPYHQNNDLSVVPMETQQQHNVVGNLASQQQLEEQNN 130


>At1g33060.2 68414.m04076 no apical meristem (NAM) family protein
           similar to NAC1 GB:AAF68626 GI:7716952 from (Medicago
           truncatula)
          Length = 652

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -2

Query: 572 HSTFVSERRNF-LGNVASWPGALNLLGTSVPF 480
           H+   ++R++F L N+  WPG   LL T  PF
Sbjct: 344 HNESSNDRKDFVLPNMMHWPGNTRLLSTEYPF 375


>At1g33060.1 68414.m04075 no apical meristem (NAM) family protein
           similar to NAC1 GB:AAF68626 GI:7716952 from (Medicago
           truncatula)
          Length = 648

 Score = 29.5 bits (63), Expect = 1.7
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = -2

Query: 572 HSTFVSERRNF-LGNVASWPGALNLLGTSVPF 480
           H+   ++R++F L N+  WPG   LL T  PF
Sbjct: 344 HNESSNDRKDFVLPNMMHWPGNTRLLSTEYPF 375


>At5g54050.1 68418.m06722 DC1 domain-containing protein 
          Length = 580

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 14/32 (43%), Positives = 17/32 (53%)
 Frame = +3

Query: 264 LENVEVPDENEEIKRPLVDLRNPGPPQHQEHE 359
           LE  +VP+E EEIK P   +   G   H  HE
Sbjct: 272 LELEDVPEEEEEIKDPFKVINEKGDIVHFSHE 303


>At1g27850.1 68414.m03413 expressed protein similar to En/Spm-like
           transposon protein GB:AAB95292 GI:2088658 from
           [Arabidopsis thaliana]
          Length = 1148

 Score = 29.1 bits (62), Expect = 2.2
 Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +3

Query: 249 VVKSDLENVEVPDENEE-IKRPLVDLRNPGPPQHQEHETQNPEHHEDAEK 395
           V +S++EN+  PD++EE I   +V+L N    +H+ HE+   +   D ++
Sbjct: 448 VFQSEVENLAYPDKHEESIAFGMVNLSNES-SRHESHESSFSDQLGDMDQ 496


>At2g30410.1 68415.m03704 tubulin folding cofactor A (KIESEL)
           identical to cDNA tubulin folding cofactor A,
           GI:20514256, SP|O04350 Tubulin-specific chaperone A
           (Tubulin-folding cofactor A) (CFA) (TCP1-chaperonin
           cofactor A homolog) {Arabidopsis thaliana}
          Length = 113

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 15/52 (28%), Positives = 28/52 (53%)
 Frame = +3

Query: 279 VPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAE 434
           +PD ++ ++  L DL++      +  E + PE  EDA+K V+ V+    T +
Sbjct: 62  IPDCHKRLESALADLKSTLAELEETDEKEGPE-IEDAKKTVADVEKQFPTED 112


>At2g23950.1 68415.m02860 leucine-rich repeat family protein /
           protein kinase family protein contains Pfam domains
           PF00560: Leucine Rich Repeat and PF00069: Protein kinase
           domain
          Length = 634

 Score = 28.7 bits (61), Expect = 2.9
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 1/47 (2%)
 Frame = -2

Query: 155 AWSMSSCSLDKLSTTFKGLS-SASGTLSGMAGCACGEHEYS*QQGRV 18
           +W+M SCS D L       S S SGTLSG  G      + S Q   +
Sbjct: 64  SWTMISCSSDNLVIGLGAPSQSLSGTLSGSIGNLTNLRQVSLQNNNI 110


>At1g51070.1 68414.m05741 basic helix-loop-helix (bHLH) family
           protein similar to bHLH transcription factor GI:3757520
           from [Arabidopsis thaliana]
          Length = 226

 Score = 28.3 bits (60), Expect = 3.8
 Identities = 22/96 (22%), Positives = 48/96 (50%)
 Frame = +1

Query: 73  PDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVIVEEIKPS 252
           P + P+  DK   + D +    +  D+A  +KD+++SL+   KE+ D   K  + + K  
Sbjct: 95  PGRTPKT-DKVAIINDAIRMVNQARDEAQKLKDLNSSLQEKIKELKD--EKNELRDEKQK 151

Query: 253 LRVI*KTLKCRMKMRKSRGL*SI*EIPGPRSIKSTK 360
           L+V  + +  ++K  K++       +P P+++   +
Sbjct: 152 LKVEKERIDQQLKAIKTQPQPQPCFLPNPQTLSQAQ 187


>At5g54030.1 68418.m06720 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 419

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +3

Query: 264 LENVEVPDENEEIKRPLVDLRNPGPPQHQEHE 359
           LE  +VP+E EEI+ P   + + G   H  HE
Sbjct: 250 LELEDVPEEEEEIEDPFKVINDKGDIIHFSHE 281


>At4g09010.1 68417.m01488 L-ascorbate peroxidase, chloroplast,
           putative identical to SP|P82281|TL29_ARATH (EC
           1.11.1.11) {Arabidopsis thaliana}; ascorbate peroxidase
           - Spinacia oleracea, (gi:1669585); contains Pfam domain
           PF00141: Peroxidase; contains TIGRfam domain TIGR01409: 
           Tat (twin-arginine translocation) pathway signal
           sequence; identical to ascorbate peroxidase APX4
           (AT4g09010) mRNA, partial cds GI:31980499
          Length = 349

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = +1

Query: 451 ASRKCQTVLENGTLVPSKLRAPGQLATFPRKFRRSD 558
           A RKC    E G L+ +   + GQ   F R F RSD
Sbjct: 199 AIRKCGGNEEKGNLLYTAYGSAGQWGLFDRNFGRSD 234


>At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC)
            family protein similar to SMC1 protein [Bos taurus]
            GI:4235253, 14S cohesin SMC1 subunit (SMC protein)
            [Xenopus laevis] GI:3328231; contains Pfam profiles
            PF02483: SMC family C-terminal domain, PF02463:
            RecF/RecN/SMC N terminal domain
          Length = 1257

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 8/88 (9%)
 Frame = +1

Query: 67   AIPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDID------NSLRANKKEVIDIPVKV 228
            +I DK+P+ E +  N+++ +   +  + +A    ++D      N L     E++D   K 
Sbjct: 746  SIKDKLPQLEQEERNIIEEIDRIKPELSKAIARTEVDKRKTEMNKLEKRMNEIVDRIYKD 805

Query: 229  IVEEI-KPSLRVI*KT-LKCRMKMRKSR 306
              + +  P++RV  +T LK   K  + R
Sbjct: 806  FSQSVGVPNIRVYEETQLKTAEKEAEER 833


>At3g15920.1 68416.m02013 phox (PX) domain-containing protein weak
           similarity to myosin heavy chain [Rana catesbeiana]
           GI:4249699; contains Pfam profile PF00787: PX domain
          Length = 755

 Score = 27.5 bits (58), Expect = 6.7
 Identities = 16/60 (26%), Positives = 30/60 (50%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEIALRQ 449
           N  +  EN+ + + + D+R      H+EHE    +   + + +V  VK+ + T +  LRQ
Sbjct: 526 NESLVQENQMLLQQINDIRENFENFHKEHEELEVKAKAELKVLVKEVKS-LRTTQSDLRQ 584


>At5g54040.1 68418.m06721 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 596

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +3

Query: 264 LENVEVPDENEEIKRPLVDLRNPGPPQHQEHE 359
           LE  +VP+E EEI+ P   +   G   H  HE
Sbjct: 265 LELEDVPEEEEEIEDPFKVINEKGDIIHFSHE 296


>At3g54220.1 68416.m05993 scarecrow transcription factor, putative
           nearly identical to SCARECROW [Arabidopsis thaliana]
           GI:1497987
          Length = 653

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 11/34 (32%), Positives = 17/34 (50%), Gaps = 1/34 (2%)
 Frame = +3

Query: 285 DENEEIKRPLVDL-RNPGPPQHQEHETQNPEHHE 383
           D + +   PL  +  NP PPQ Q+   Q  + H+
Sbjct: 198 DPSPQTFEPLYQISNNPSPPQQQQQHQQQQQQHK 231



 Score = 27.1 bits (57), Expect = 8.9
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 2/67 (2%)
 Frame = +3

Query: 270 NVEVPDENEEIKRPLVDLRNPGPP-QHQEHETQNPEHHEDAEKIVSSVKN-DINTAEIAL 443
           N   P + ++ ++     + P PP Q QE E  + +     E + ++V     NTAE AL
Sbjct: 213 NPSPPQQQQQHQQQQQQHKPPPPPIQQQERENSSTDAPPQPETVTATVPAVQTNTAE-AL 271

Query: 444 RQGFQEV 464
           R+  +E+
Sbjct: 272 RERKEEI 278


>At3g28600.1 68416.m03570 AAA-type ATPase family protein contains
           Pfam profile: ATPase family PF00004
          Length = 475

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +1

Query: 70  IPDKVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKK 201
           I   + E +  P +V +NL  +   ID   ++KD+  +L   KK
Sbjct: 405 IESLLKETKIAPADVAENLMKKNTEIDADGSLKDLIQALEGKKK 448


>At3g24440.1 68416.m03067 fibronectin type III domain-containing
           protein contains Pfam profile PF00041: Fibronectin type
           III domain
          Length = 602

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 1/65 (1%)
 Frame = +3

Query: 261 DLENVEVPDENEEIKRP-LVDLRNPGPPQHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 437
           DL  V VPD NEE   P      + G P +   E    +H ++ +  VS+ +   N   +
Sbjct: 421 DLNVVSVPDLNEEFTPPDSSGGEDNGVPLNSLAEADGGDHDDNCDDAVSNGRRKNNNDCL 480

Query: 438 ALRQG 452
            +  G
Sbjct: 481 VISDG 485


>At3g06720.2 68416.m00797 importin alpha-1 subunit, putative (IMPA1)
           similar to importin alpha-1 subunit (Karyopherin alpha-1
           subunit, KAP alpha) [Arabidopsis thaliana]
           SWISS-PROT:Q96321
          Length = 532

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 16/51 (31%), Positives = 28/51 (54%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVI 231
           KV EAE K L    +++   +LID A  ++ I+N    +  E+ +  VK++
Sbjct: 441 KVGEAE-KNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKIL 490


>At3g06720.1 68416.m00796 importin alpha-1 subunit, putative (IMPA1)
           similar to importin alpha-1 subunit (Karyopherin alpha-1
           subunit, KAP alpha) [Arabidopsis thaliana]
           SWISS-PROT:Q96321
          Length = 532

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 16/51 (31%), Positives = 28/51 (54%)
 Frame = +1

Query: 79  KVPEAEDKPLNVVDNLSSEQELIDQANTIKDIDNSLRANKKEVIDIPVKVI 231
           KV EAE K L    +++   +LID A  ++ I+N    +  E+ +  VK++
Sbjct: 441 KVGEAE-KNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKIL 490


>At2g36890.1 68415.m04524 myb family transcription factor (MYB38)
           contains Pfam profile: PF00249 myb-like DNA-binding
           domain
          Length = 298

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 10/32 (31%), Positives = 16/32 (50%)
 Frame = +3

Query: 342 QHQEHETQNPEHHEDAEKIVSSVKNDINTAEI 437
           +H++H+  +  H ED   + S V  D    EI
Sbjct: 237 EHRDHDDHHHHHEEDERSMTSVVMEDYGMEEI 268


>At1g26580.1 68414.m03238 expressed protein similar to putative MYB
           family transcription factor GB:AAD17429 GI:4335752 from
           [Arabidopsis thaliana]
          Length = 493

 Score = 27.1 bits (57), Expect = 8.9
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +3

Query: 339 PQHQEHETQNPEHHEDAEKIVSSVKND 419
           P HQ  +   P HHE+ E+ VS   ND
Sbjct: 346 PLHQGTKKVYPLHHEEGEEDVSHSSND 372


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,393,201
Number of Sequences: 28952
Number of extensions: 192680
Number of successful extensions: 859
Number of sequences better than 10.0: 28
Number of HSP's better than 10.0 without gapping: 829
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 858
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1112061928
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -