SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20056
         (750 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS...   199   1e-51
At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS...   199   1e-51
At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta...   196   2e-50
At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS...   188   3e-48
At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70...   120   1e-27
At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70...   113   1e-25
At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)...   105   2e-23
At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)...   105   2e-23
At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)...   105   2e-23
At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)...   102   3e-22
At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70...    87   9e-18
At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)...    86   3e-17
At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, p...    82   4e-16
At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)...    81   8e-16
At1g79930.1 68414.m09340 heat shock protein, putative contains P...    54   1e-07
At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70...    52   3e-07
At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70...    52   3e-07
At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70...    52   4e-07
At1g11660.1 68414.m01339 heat shock protein, putative strong sim...    44   1e-04
At2g32120.2 68415.m03926 heat shock protein 70 family protein / ...    37   0.016
At2g32120.1 68415.m03925 heat shock protein 70 family protein / ...    37   0.016
At3g63200.1 68416.m07100 patatin-related low similarity to patat...    34   0.12 
At4g24910.1 68417.m03566 hypothetical protein contains Pfam prof...    29   2.5  
At2g27350.5 68415.m03295 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.4 68415.m03294 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.3 68415.m03293 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.2 68415.m03292 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.1 68415.m03291 OTU-like cysteine protease family prote...    29   4.4  
At4g27630.2 68417.m03972 expressed protein                             28   5.8  
At4g34940.1 68417.m04953 armadillo/beta-catenin repeat family pr...    28   7.6  
At1g73390.3 68414.m08497 expressed protein                             28   7.6  
At1g73390.2 68414.m08496 expressed protein                             28   7.6  
At1g73390.1 68414.m08495 expressed protein                             28   7.6  

>At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2
           (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock
           cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis
           thaliana}
          Length = 653

 Score =  199 bits (486), Expect = 1e-51
 Identities = 126/238 (52%), Positives = 150/238 (63%), Gaps = 14/238 (5%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 PTTQYSMPNVSSDVSSKMLLCKPT*STGL-SSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
           P        V++   +K L+ +      + S  Q W  T   G+       +  +G +  
Sbjct: 66  P--------VNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQ 117

Query: 435 GAYENEGNCRSLSWQNCAECSYHGS----------AYFNDSQRQATKDAGTISGLNVLRI 584
            A E   +   +  +  AE ++ G+          AYFNDSQRQATKDAG I+GLNVLRI
Sbjct: 118 FAAEEISSMVLIKMREIAE-AFLGTTVKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI 176

Query: 585 INEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           INEPTAAAIAYGLDKK T  GE+NVLIFDLGGGT     L         +   GDTHL
Sbjct: 177 INEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL 234



 Score = 70.9 bits (166), Expect = 8e-13
 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGG-KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F ++S    KP I V YKGE+K F  EE+SSMVL KM+E AEA+LG TV+NAV+TVP
Sbjct: 95  FTIISGTAEKPMIVVEYKGEEKQFAAEEISSMVLIKMREIAEAFLGTTVKNAVVTVP 151



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F DA+VQ+D + WPF +
Sbjct: 65  NPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTI 97


>At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3
           (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock
           cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis
           thaliana}
          Length = 649

 Score =  199 bits (486), Expect = 1e-51
 Identities = 125/237 (52%), Positives = 149/237 (62%), Gaps = 13/237 (5%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 PTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHG 437
           P       N   D + +++  + T S+  S  + W  T   G        +  +G     
Sbjct: 66  PI------NTVFD-AKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEF 118

Query: 438 AYENEGNCRSLSWQNCAECSYHGS----------AYFNDSQRQATKDAGTISGLNVLRII 587
           + E   +   +  +  AE +Y G+          AYFNDSQRQATKDAG I+GLNV+RII
Sbjct: 119 SAEEISSMILIKMREIAE-AYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRII 177

Query: 588 NEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           NEPTAAAIAYGLDKK T  GE+NVLIFDLGGGT     L         +   GDTHL
Sbjct: 178 NEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL 234



 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 33/48 (68%), Positives = 39/48 (81%)
 Frame = +1

Query: 367 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           KP I V YKGEDK F  EE+SSM+L KM+E AEAYLG T++NAV+TVP
Sbjct: 104 KPMIVVNYKGEDKEFSAEEISSMILIKMREIAEAYLGTTIKNAVVTVP 151



 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 22/33 (66%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR+F D++VQ+D+K WPF L
Sbjct: 65  NPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTL 97


>At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein,
           putative / HSC70, putative / HSP70, putative strong
           similarity to heat shock cognate 70 kd protein 1
           SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)]
          Length = 617

 Score =  196 bits (477), Expect = 2e-50
 Identities = 125/238 (52%), Positives = 147/238 (61%), Gaps = 14/238 (5%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 PTTQYSMPNVSSDVSSKMLLCKPT*STGL-SSCQ*WRQT*DQGSI*G*RQNLFPRGSQFH 434
           P        V++   +K L+ +      + S  + W      G        +  +G +  
Sbjct: 66  P--------VNTVFDAKRLIGRRFSDASVQSDMKFWPFKVTPGQADKPMIFVNYKGEEKQ 117

Query: 435 GAYENEGNCRSLSWQNCAECSYHGS----------AYFNDSQRQATKDAGTISGLNVLRI 584
            A E   +   +  +  AE +Y GS          AYFNDSQRQATKDAG I+GLNVLRI
Sbjct: 118 FAAEEISSMVLIKMREIAE-AYLGSSIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRI 176

Query: 585 INEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           INEPTAAAIAYGLDKK T  G +NVLIFDLGGGT     L         +   GDTHL
Sbjct: 177 INEPTAAAIAYGLDKKATSVGIKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL 234



 Score = 69.7 bits (163), Expect = 2e-12
 Identities = 32/48 (66%), Positives = 39/48 (81%)
 Frame = +1

Query: 367 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG +++NAV+TVP
Sbjct: 104 KPMIFVNYKGEEKQFAAEEISSMVLIKMREIAEAYLGSSIKNAVVTVP 151



 Score = 59.3 bits (137), Expect = 3e-09
 Identities = 24/39 (61%), Positives = 34/39 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEAN 370
           +P NT+FDAKRLIGR+F DA+VQ+DMK WPF+++  +A+
Sbjct: 65  NPVNTVFDAKRLIGRRFSDASVQSDMKFWPFKVTPGQAD 103


>At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1
           (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}
          Length = 651

 Score =  188 bits (459), Expect = 3e-48
 Identities = 121/237 (51%), Positives = 145/237 (61%), Gaps = 13/237 (5%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 PTTQYSMPNVSSDVSSKMLLCKPT*STGLSSCQ*WRQT*DQGSI*G*RQNLFPRGSQFHG 437
           P       N   D + +++  + + S+  S  + W      G        +  +G +   
Sbjct: 66  PV------NTVFD-AKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEF 118

Query: 438 AYENEGNCRSLSWQNCAECSYHGSAYFN----------DSQRQATKDAGTISGLNVLRII 587
           A E   +   +  +  AE +Y G    N          DSQRQATKDAG I+GLNV+RII
Sbjct: 119 AAEEISSMVLIKMREIAE-AYLGVTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRII 177

Query: 588 NEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTSTCPSLP-SRRYLRGEIHRGDTHL 749
           NEPTAAAIAYGLDKK T  GE+NVLIFDLGGGT     L         +   GDTHL
Sbjct: 178 NEPTAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHL 234



 Score = 71.3 bits (167), Expect = 6e-13
 Identities = 33/48 (68%), Positives = 39/48 (81%)
 Frame = +1

Query: 367 KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           KP I V YKGE+K F  EE+SSMVL KM+E AEAYLG T++NAV+TVP
Sbjct: 104 KPMIYVEYKGEEKEFAAEEISSMVLIKMREIAEAYLGVTIKNAVVTVP 151



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 23/39 (58%), Positives = 32/39 (82%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEAN 370
           +P NT+FDAKRLIGR+F D++VQ+DMK WPF++    A+
Sbjct: 65  NPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPAD 103


>At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein
           GI:425194 [Spinacia oleracea]
          Length = 650

 Score =  120 bits (288), Expect = 1e-27
 Identities = 54/62 (87%), Positives = 59/62 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 PT 263
           PT
Sbjct: 66  PT 67



 Score =  108 bits (260), Expect = 3e-24
 Identities = 58/83 (69%), Positives = 62/83 (74%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGGT 
Sbjct: 152 AYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGGTF 211

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 212 DVSLLTIEEGIFEVKATAGDTHL 234



 Score = 70.9 bits (166), Expect = 8e-13
 Identities = 36/57 (63%), Positives = 44/57 (77%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGG-KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVS  G KP I V +KGE+K F  EE+SSMVL KM+E AEA+LG  V+NAV+TVP
Sbjct: 95  FKVVSGPGEKPMIVVNHKGEEKQFSAEEISSMVLIKMREIAEAFLGSPVKNAVVTVP 151



 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 21/33 (63%), Positives = 28/33 (84%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGR++ D +VQAD  HWPF++
Sbjct: 65  NPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKV 97


>At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70,
           putative similar to heat shock protein hsp70 GI:1771478
           from [Pisum sativum]
          Length = 646

 Score =  113 bits (272), Expect = 1e-25
 Identities = 61/83 (73%), Positives = 63/83 (75%), Gaps = 3/83 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGGTS 683
           AYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKGT  GE+NVLIFDLGGGT 
Sbjct: 151 AYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKGTKAGEKNVLIFDLGGGTF 210

Query: 684 TCPSLP-SRRYLRGEIHRGDTHL 749
               L         +   GDTHL
Sbjct: 211 DVSLLTIEEGVFEVKATAGDTHL 233



 Score =  108 bits (259), Expect = 4e-24
 Identities = 49/58 (84%), Positives = 54/58 (93%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           A+GIDLGTTYSCVGV+ + +VEII NDQGNRTTPSYVAFTDTERLIGDAAKNQVA+ P
Sbjct: 8   AIGIDLGTTYSCVGVWMNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP 65



 Score = 80.2 bits (189), Expect = 1e-15
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGG-KPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F+VVS  G KP I V+YK E+K F PEE+SSMVL KMKE AEA+LG+TV+NAV+TVP
Sbjct: 94  FKVVSGPGEKPMIVVSYKNEEKQFSPEEISSMVLVKMKEVAEAFLGRTVKNAVVTVP 150



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 22/33 (66%), Positives = 29/33 (87%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+FDAKRLIGRKF D +VQ+D+ HWPF++
Sbjct: 64  NPQNTVFDAKRLIGRKFSDPSVQSDILHWPFKV 96


>At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 613

 Score =  105 bits (253), Expect = 2e-23
 Identities = 55/81 (67%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGT   
Sbjct: 180 AYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTFDV 238

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L     +   +   GDTHL
Sbjct: 239 SVLTIDNGVFEVLSTNGDTHL 259



 Score =  100 bits (239), Expect = 1e-21
 Identities = 44/57 (77%), Positives = 52/57 (91%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A+ P
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP 94



 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++V+  GKP I+V  K GE K F PEE+S+M+LTKMKETAEAYLGK +++AV+TVP
Sbjct: 123 YQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVP 179



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVK-----TKPFSP 418
           +P  T+FD KRLIGRKFED  VQ D K  P+++     N   + +I+VK     TK FSP
Sbjct: 93  NPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQI----VNKDGKPYIQVKIKDGETKVFSP 148

Query: 419 RK 424
            +
Sbjct: 149 EE 150


>At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 668

 Score =  105 bits (253), Expect = 2e-23
 Identities = 55/81 (67%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGT   
Sbjct: 180 AYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTFDV 238

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L     +   +   GDTHL
Sbjct: 239 SVLTIDNGVFEVLSTNGDTHL 259



 Score =  100 bits (239), Expect = 1e-21
 Identities = 44/57 (77%), Positives = 52/57 (91%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A+ P
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP 94



 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++V+  GKP I+V  K GE K F PEE+S+M+LTKMKETAEAYLGK +++AV+TVP
Sbjct: 123 YQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVP 179



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVK-----TKPFSP 418
           +P  T+FD KRLIGRKFED  VQ D K  P+++     N   + +I+VK     TK FSP
Sbjct: 93  NPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQI----VNKDGKPYIQVKIKDGETKVFSP 148

Query: 419 RK 424
            +
Sbjct: 149 EE 150


>At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)
           SWISS-PROT:Q9LKR3 PMID:8888624
          Length = 669

 Score =  105 bits (253), Expect = 2e-23
 Identities = 55/81 (67%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGT   
Sbjct: 180 AYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTFDV 238

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L     +   +   GDTHL
Sbjct: 239 SVLTIDNGVFEVLSTNGDTHL 259



 Score =  100 bits (239), Expect = 1e-21
 Identities = 44/57 (77%), Positives = 52/57 (91%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A+ P
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP 94



 Score = 76.2 bits (179), Expect = 2e-14
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 1/57 (1%)
 Frame = +1

Query: 343 FRVVSDGGKPKIKVAYK-GEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++V+  GKP I+V  K GE K F PEE+S+M+LTKMKETAEAYLGK +++AV+TVP
Sbjct: 123 YQIVNKDGKPYIQVKIKDGETKVFSPEEISAMILTKMKETAEAYLGKKIKDAVVTVP 179



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 5/62 (8%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVK-----TKPFSP 418
           +P  T+FD KRLIGRKFED  VQ D K  P+++     N   + +I+VK     TK FSP
Sbjct: 93  NPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQI----VNKDGKPYIQVKIKDGETKVFSP 148

Query: 419 RK 424
            +
Sbjct: 149 EE 150


>At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)
           Similar to Arabidopsis luminal binding protein
           (gb|D89342); contains Pfam domain PF00012: dnaK protein
          Length = 678

 Score =  102 bits (244), Expect = 3e-22
 Identities = 53/81 (65%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GLNV+RIINEPT AAIAYGLDKKG GE N+L++DLGGGT   
Sbjct: 194 AYFNDAQRQATKDAGAIAGLNVVRIINEPTGAAIAYGLDKKG-GESNILVYDLGGGTFDV 252

Query: 690 PSLPSRRYLRGEIH-RGDTHL 749
             L     +   +   GDTHL
Sbjct: 253 SILTIDNGVFEVLSTSGDTHL 273



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 45/57 (78%), Positives = 50/57 (87%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTP 260
           +GIDLGTTYSCVGV+ +  VEIIANDQGNR TPS+VAFTDTERLIG+AAKNQ A  P
Sbjct: 53  IGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAAKNP 109



 Score = 82.2 bits (194), Expect = 3e-16
 Identities = 37/58 (63%), Positives = 49/58 (84%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           L ++VV+  GKP I+V  KGE+K F PEE+S+M+LTKMKETAEA+LGK +++AVITVP
Sbjct: 136 LPYKVVNKDGKPYIQVKVKGEEKLFSPEEISAMILTKMKETAEAFLGKKIKDAVITVP 193



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 23/57 (40%), Positives = 35/57 (61%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELSVMEANLRSR*HIRVKTKPFSPRK 424
           +P  TIFD KRLIGRKF+D  VQ D+K  P+++   +     +  ++ + K FSP +
Sbjct: 108 NPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVKGEEKLFSPEE 164


>At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein 70
           [Arabidopsis thaliana] GI:6746592; similar to heat shock
           70 protein - Spinacia oleracea,PID:g2654208
          Length = 718

 Score = 87.4 bits (207), Expect = 9e-18
 Identities = 41/57 (71%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG D+K      +L+FDLGGGT
Sbjct: 220 AYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFDRK--ANETILVFDLGGGT 274



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 245
           ++     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + +RL+G  AK Q
Sbjct: 74  RVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSGDRLVGQIAKRQ 133

Query: 246 VAMTPTTQY 272
             + P   +
Sbjct: 134 AVVNPENTF 142



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 22/58 (37%), Positives = 33/58 (56%)
 Frame = +1

Query: 337 LAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           +++RVV D     +K+     +K F  EE+S+ VL K+ + A  +L   V  AVITVP
Sbjct: 163 VSYRVVRDENN-NVKLECPAINKQFAAEEISAQVLRKLVDDASRFLNDKVTKAVITVP 219


>At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746592
          Length = 718

 Score = 85.8 bits (203), Expect = 3e-17
 Identities = 40/57 (70%), Positives = 47/57 (82%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG ++K      +L+FDLGGGT
Sbjct: 220 AYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFERK--SNETILVFDLGGGT 274



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 1/69 (1%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 245
           ++     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + +RL+G  AK Q
Sbjct: 74  RVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSKDRLVGQIAKRQ 133

Query: 246 VAMTPTTQY 272
             + P   +
Sbjct: 134 AVVNPENTF 142



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 22/64 (34%), Positives = 34/64 (53%)
 Frame = +1

Query: 319 ASRHEALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAV 498
           A   + +++RV+ D     +K+      K F  EE+S+ VL K+ + A  +L   V  AV
Sbjct: 157 AEESKQVSYRVIKDENG-NVKLDCPAIGKQFAAEEISAQVLRKLVDDASRFLNDKVTKAV 215

Query: 499 ITVP 510
           ITVP
Sbjct: 216 ITVP 219


>At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial,
           putative / HSP70, mitochondrial, putative strong
           similarity to SP|Q01899 Heat shock 70 kDa protein,
           mitochondrial precursor {Phaseolus vulgaris}
          Length = 682

 Score = 81.8 bits (193), Expect = 4e-16
 Identities = 39/57 (68%), Positives = 48/57 (84%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGT 680
           AYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG++ K   E  + +FDLGGGT
Sbjct: 194 AYFNDAQRQATKDAGKIAGLDVQRIINEPTAAALSYGMNNK---EGVIAVFDLGGGT 247



 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPT 263
           +GIDLGTT SCV V +     +I N +G+RTTPS VA     E L+G  AK Q    PT
Sbjct: 55  IGIDLGTTNSCVSVMEGKTARVIENAEGSRTTPSVVAMNQKGELLVGTPAKRQAVTNPT 113



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 22/34 (64%), Positives = 28/34 (82%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           F P ++ + VLTKMKETAEAYLGK++  AV+TVP
Sbjct: 160 FSPSQIGANVLTKMKETAEAYLGKSINKAVVTVP 193



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 17/33 (51%), Positives = 25/33 (75%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NTIF +KRLIGR+F+D   Q +MK  P+++
Sbjct: 111 NPTNTIFGSKRLIGRRFDDPQTQKEMKMVPYKI 143


>At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746590
          Length = 682

 Score = 81.0 bits (191), Expect = 8e-16
 Identities = 45/81 (55%), Positives = 54/81 (66%), Gaps = 1/81 (1%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTSTC 689
           AYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG+  K   E  + +FDLGGGT   
Sbjct: 199 AYFNDAQRQATKDAGRIAGLDVERIINEPTAAALSYGMTNK---EGLIAVFDLGGGTFDV 255

Query: 690 PSLP-SRRYLRGEIHRGDTHL 749
             L  S      +   GDT L
Sbjct: 256 SVLEISNGVFEVKATNGDTFL 276



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 34/70 (48%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQ 245
           K A    +GIDLGTT SCV V +    ++I N +G RTTPS VAF T  E L+G  AK Q
Sbjct: 53  KPAGNDVIGIDLGTTNSCVAVMEGKNPKVIENAEGARTTPSVVAFNTKGELLVGTPAKRQ 112

Query: 246 VAMTPTTQYS 275
               PT   S
Sbjct: 113 AVTNPTNTVS 122



 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 21/34 (61%), Positives = 28/34 (82%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVP 510
           + P ++ + +LTKMKETAEAYLGK+V  AV+TVP
Sbjct: 165 YSPSQIGAFILTKMKETAEAYLGKSVTKAVVTVP 198



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 16/33 (48%), Positives = 23/33 (69%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEL 352
           +P NT+   KRLIGRKF+D   Q +MK  P+++
Sbjct: 116 NPTNTVSGTKRLIGRKFDDPQTQKEMKMVPYKI 148


>At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam
           profile: PF00012 Heat shock hsp70 proteins; similar to
           heat-shock proteins GB:CAA94389, GB:AAD55461
           [Arabidopsis thaliana]
          Length = 831

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 28/64 (43%), Positives = 39/64 (60%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLI 659
           +C      YF D QR+A  DA TI+GL+ LR+I+E TA A+AYG+   D   + + NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALAYGIYKTDLPESDQLNVAF 198

Query: 660 FDLG 671
            D+G
Sbjct: 199 IDIG 202



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 270 YS 275
            S
Sbjct: 64  IS 65



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P N+I   KRLIGR+F D  +Q D+K  PF ++
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVT 92


>At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 659
           +C      YF D QR+A  DA TI+GL+ L +I+E TA A+AYG+ K    E    NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALAYGIYKTDLPENDQLNVAF 198

Query: 660 FDLG 671
            D+G
Sbjct: 199 IDIG 202



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 270 YS 275
            S
Sbjct: 64  IS 65



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P N+I   KRLIGR+F D  +Q D+K  PF ++
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVT 92


>At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 3/64 (4%)
 Frame = +3

Query: 489 ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 659
           +C      YF D QR+A  DA TI+GL+ L +I+E TA A+AYG+ K    E    NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALAYGIYKTDLPENDQLNVAF 198

Query: 660 FDLG 671
            D+G
Sbjct: 199 IDIG 202



 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 22/62 (35%), Positives = 30/62 (48%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 270 YS 275
            S
Sbjct: 64  IS 65



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 16/34 (47%), Positives = 23/34 (67%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFELS 355
           +P N+I   KRLIGR+F D  +Q D+K  PF ++
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVT 92


>At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70,
           putative
          Length = 867

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 21/58 (36%), Positives = 38/58 (65%), Gaps = 1/58 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLGGGTS 683
           YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+G  ++
Sbjct: 172 YFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGSSST 229



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGV--FQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +++  + +DLG+ +  V V   + G+  + +  N+   R +P+ VAF   +RL+G+ A  
Sbjct: 22  SESAVLSVDLGSEWVKVAVVNLKRGQSPISVAINEMSKRKSPALVAFQSGDRLLGEEAAG 81

Query: 243 QVAMTPTTQYS 275
             A  P   YS
Sbjct: 82  ITARYPNKVYS 92


>At1g11660.1 68414.m01339 heat shock protein, putative strong
           similarity to gb|Z70314 heat-shock protein from
           Arabidopsis thaliana and is a member of the PF|00012
           Hsp70 protein family
          Length = 773

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G     + V +   ++++ ND+ NR  P+ V+F + +R +G AA     M P + 
Sbjct: 4   VGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHPKST 63

Query: 270 YS 275
            S
Sbjct: 64  IS 65



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 28/93 (30%), Positives = 46/93 (49%), Gaps = 5/93 (5%)
 Frame = +3

Query: 486 AECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERNV 653
           ++C     +YF +SQR A  DA  I+GL  LR++++ TA A+ YG+ K      +    +
Sbjct: 138 SDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALGYGIYKTDLVANSSPTYI 197

Query: 654 LIFDLGG-GTSTCPSLPSRRYLRGEIHRGDTHL 749
           +  D+G   T  C +      +R   H  D +L
Sbjct: 198 VFIDIGHCDTQVCVASFESGSMRVRSHAFDRNL 230



 Score = 41.1 bits (92), Expect = 8e-04
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFELSV-MEANLRSR*HIRVKTKPFSP 418
           P +TI   KRLIGRKF +  VQ D++ +PFE S   +  ++ R     + + FSP
Sbjct: 60  PKSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSP 114


>At2g32120.2 68415.m03926 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 36.7 bits (81), Expect = 0.016
 Identities = 20/64 (31%), Positives = 35/64 (54%)
 Frame = +1

Query: 319 ASRHEALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAV 498
           AS++     + +  G +P I        ++  PEEV ++ L +++  AEA L + V+N V
Sbjct: 111 ASKNLPFLVQTLDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRLMAEAQLKRPVRNVV 170

Query: 499 ITVP 510
           +TVP
Sbjct: 171 LTVP 174



 Score = 34.7 bits (76), Expect = 0.066
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 8/62 (12%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLIFDLG 671
           F+  Q    + A  ++GL+VLR++ EPTA A+ Y         D  G+G ER  +IF++G
Sbjct: 177 FSRFQLTRFERACAMAGLHVLRLMPEPTAIALLYAQQQQMTTHDNMGSGSERLAVIFNMG 236

Query: 672 GG 677
            G
Sbjct: 237 AG 238



 Score = 34.3 bits (75), Expect = 0.088
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 209
           A+GID+GT+   + V+   +V I+ N +  +   S+V F D
Sbjct: 30  ALGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFKD 70


>At2g32120.1 68415.m03925 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 36.7 bits (81), Expect = 0.016
 Identities = 20/64 (31%), Positives = 35/64 (54%)
 Frame = +1

Query: 319 ASRHEALAFRVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAV 498
           AS++     + +  G +P I        ++  PEEV ++ L +++  AEA L + V+N V
Sbjct: 111 ASKNLPFLVQTLDIGVRPFIAALVNNAWRSTTPEEVLAIFLVELRLMAEAQLKRPVRNVV 170

Query: 499 ITVP 510
           +TVP
Sbjct: 171 LTVP 174



 Score = 34.7 bits (76), Expect = 0.066
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 8/62 (12%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLIFDLG 671
           F+  Q    + A  ++GL+VLR++ EPTA A+ Y         D  G+G ER  +IF++G
Sbjct: 177 FSRFQLTRFERACAMAGLHVLRLMPEPTAIALLYAQQQQMTTHDNMGSGSERLAVIFNMG 236

Query: 672 GG 677
            G
Sbjct: 237 AG 238



 Score = 34.3 bits (75), Expect = 0.088
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 209
           A+GID+GT+   + V+   +V I+ N +  +   S+V F D
Sbjct: 30  ALGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFKD 70


>At3g63200.1 68416.m07100 patatin-related low similarity to
           patatin-like latex protein allergen Hev b 7 - Hevea
           brasiliensis, EMBL:AF113546; contains patatin domain
           PF01734
          Length = 384

 Score = 33.9 bits (74), Expect = 0.12
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 5/51 (9%)
 Frame = +3

Query: 582 IINEPTAAAIAYGLDKKG-----TGERNVLIFDLGGGTSTCPSLPSRRYLR 719
           ++N PTAAA+ + L  K       G  ++L+  LG G ST  S P R+  R
Sbjct: 225 VMNNPTAAAVTHVLHNKRDFPSVNGVDDLLVLSLGNGPSTMSSSPGRKLRR 275


>At4g24910.1 68417.m03566 hypothetical protein contains Pfam profile
           PF04669: Protein of unknown function (DUF579)
          Length = 315

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = -1

Query: 195 HKTEWSCCPGRWR*SPPSRAG--RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQL 28
           H++  S      R SPPS     +HQR ST    +F +R L+P  IF  S    L+ L
Sbjct: 6   HQSSLSILNPLLRFSPPSSPDNPKHQRLSTIKMPKFTVRKLIPLLIFVLSSLSVLRLL 63


>At2g27350.5 68415.m03295 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 388

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.4 68415.m03294 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 388

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.3 68415.m03293 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 506

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.2 68415.m03292 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.1 68415.m03291 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At4g27630.2 68417.m03972 expressed protein
          Length = 467

 Score = 28.3 bits (60), Expect = 5.8
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = -1

Query: 132 RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLSKR 19
           R  R   W  D F L VLL F +    CYL L+    R
Sbjct: 71  REARMVNWKVDLFCLIVLLVFMLPYYHCYLMLRNTGVR 108


>At4g34940.1 68417.m04953 armadillo/beta-catenin repeat family
           protein contains Pfam profile: PF00514
           armadillo/beta-catenin-like repeat
          Length = 664

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 11/44 (25%), Positives = 22/44 (50%)
 Frame = +2

Query: 203 HRHRASHRRCRQEPGGDDPNNTIFDAKRLIGRKFEDATVQADMK 334
           ++   +H +    P G++P +       + GR++ED   +A MK
Sbjct: 378 NQQHQNHTKGGSNPRGNNPTHVSLMGTSIKGREYEDPATKAQMK 421


>At1g73390.3 68414.m08497 expressed protein
          Length = 419

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/61 (22%), Positives = 33/61 (54%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSMTLKDKPQKMQVPSLA*TFSESS 588
           +  E++     +K++   + Y  + +     T+P  ++ LK  P + Q+PS+  ++SE+S
Sbjct: 352 YLSEKIPKETSSKVRINRDLYSYEKIMETAPTLPDFALALK--PDEYQLPSVDASWSEAS 409

Query: 589 M 591
           +
Sbjct: 410 L 410


>At1g73390.2 68414.m08496 expressed protein
          Length = 419

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/61 (22%), Positives = 33/61 (54%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSMTLKDKPQKMQVPSLA*TFSESS 588
           +  E++     +K++   + Y  + +     T+P  ++ LK  P + Q+PS+  ++SE+S
Sbjct: 352 YLSEKIPKETSSKVRINRDLYSYEKIMETAPTLPDFALALK--PDEYQLPSVDASWSEAS 409

Query: 589 M 591
           +
Sbjct: 410 L 410


>At1g73390.1 68414.m08495 expressed protein
          Length = 419

 Score = 27.9 bits (59), Expect = 7.6
 Identities = 14/61 (22%), Positives = 33/61 (54%)
 Frame = +1

Query: 409 FFPEEVSSMVLTKMKETAEAYLGKTVQNAVITVPRTSMTLKDKPQKMQVPSLA*TFSESS 588
           +  E++     +K++   + Y  + +     T+P  ++ LK  P + Q+PS+  ++SE+S
Sbjct: 352 YLSEKIPKETSSKVRINRDLYSYEKIMETAPTLPDFALALK--PDEYQLPSVDASWSEAS 409

Query: 589 M 591
           +
Sbjct: 410 L 410


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,291,360
Number of Sequences: 28952
Number of extensions: 417404
Number of successful extensions: 1397
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1266
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1375
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1663169840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -