SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20055
         (759 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70...   161   6e-40
At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS...   157   6e-39
At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS...   157   1e-38
At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS...   157   1e-38
At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70...   156   1e-38
At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta...   154   5e-38
At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)...   149   2e-36
At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)...   149   2e-36
At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)...   149   2e-36
At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)...   147   6e-36
At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70...   130   1e-30
At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)...   128   3e-30
At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, p...   120   8e-28
At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)...   119   2e-27
At1g79930.1 68414.m09340 heat shock protein, putative contains P...    69   4e-12
At1g11660.1 68414.m01339 heat shock protein, putative strong sim...    69   4e-12
At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70...    67   1e-11
At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70...    67   1e-11
At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70...    56   3e-08
At2g32120.2 68415.m03926 heat shock protein 70 family protein / ...    52   5e-07
At2g32120.1 68415.m03925 heat shock protein 70 family protein / ...    52   5e-07
At5g41310.1 68418.m05020 kinesin motor protein-related                 32   0.48 
At4g24910.1 68417.m03566 hypothetical protein contains Pfam prof...    29   2.5  
At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product...    29   2.5  
At5g62550.1 68418.m07850 expressed protein                             29   3.4  
At2g21380.1 68415.m02544 kinesin motor protein-related                 29   3.4  
At3g11330.1 68416.m01378 leucine-rich repeat family protein            29   4.4  
At2g27350.5 68415.m03295 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.4 68415.m03294 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.3 68415.m03293 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.2 68415.m03292 OTU-like cysteine protease family prote...    29   4.4  
At2g27350.1 68415.m03291 OTU-like cysteine protease family prote...    29   4.4  
At4g34940.1 68417.m04953 armadillo/beta-catenin repeat family pr...    28   5.9  
At4g27630.2 68417.m03972 expressed protein                             28   5.9  
At1g06850.1 68414.m00730 bZIP transcription factor, putative con...    28   7.7  

>At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70,
           putative similar to heat shock protein hsp70 GI:1771478
           from [Pisum sativum]
          Length = 646

 Score =  161 bits (390), Expect = 6e-40
 Identities = 77/86 (89%), Positives = 82/86 (95%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG ISGLNVLRIINEPTAAAIAYGLDKKGT  GE+NVLIFDLGGG
Sbjct: 149 VPAYFNDSQRQATKDAGAISGLNVLRIINEPTAAAIAYGLDKKGTKAGEKNVLIFDLGGG 208

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+G+FEVK+TAGDTH G
Sbjct: 209 TFDVSLLTIEEGVFEVKATAGDTHLG 234



 Score =  130 bits (314), Expect = 1e-30
 Identities = 60/88 (68%), Positives = 73/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGG-KPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGRKF D +VQ+D+ HWPF+VVS  G KP I V+YK E+K F PEE+
Sbjct: 63  LNPQNTVFDAKRLIGRKFSDPSVQSDILHWPFKVVSGPGEKPMIVVSYKNEEKQFSPEEI 122

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KMKE AEA+LG+TV+NAV+T P
Sbjct: 123 SSMVLVKMKEVAEAFLGRTVKNAVVTVP 150



 Score =  105 bits (253), Expect = 2e-23
 Identities = 49/58 (84%), Positives = 53/58 (91%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           A+GIDLGTTYSCVGV+ + +VEII NDQGNRTTPSYVAFTDTERLIGDAAKNQVA  P
Sbjct: 8   AIGIDLGTTYSCVGVWMNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVALNP 65


>At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2
           (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock
           cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis
           thaliana}
          Length = 653

 Score =  157 bits (382), Expect = 6e-39
 Identities = 76/86 (88%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGG
Sbjct: 150 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGG 209

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 210 TFDVSLLTIEEGIFEVKATAGDTHLG 235



 Score =  117 bits (281), Expect = 1e-26
 Identities = 55/88 (62%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGG-KPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F DA+VQ+D + WPF ++S    KP I V YKGE+K F  EE+
Sbjct: 64  MNPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEI 123

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEA+LG TV+NAV+T P
Sbjct: 124 SSMVLIKMREIAEAFLGTTVKNAVVTVP 151



 Score =  114 bits (274), Expect = 7e-26
 Identities = 52/61 (85%), Positives = 57/61 (93%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 261 P 263
           P
Sbjct: 66  P 66


>At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1
           (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}
          Length = 651

 Score =  157 bits (380), Expect = 1e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGG
Sbjct: 150 VPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGG 209

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 210 TFDVSLLTIEEGIFEVKATAGDTHLG 235



 Score =  119 bits (286), Expect = 2e-27
 Identities = 55/88 (62%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F D++VQ+DMK WPF++      KP I V YKGE+K F  EE+
Sbjct: 64  MNPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEI 123

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEAYLG T++NAV+T P
Sbjct: 124 SSMVLIKMREIAEAYLGVTIKNAVVTVP 151



 Score =  114 bits (274), Expect = 7e-26
 Identities = 52/61 (85%), Positives = 57/61 (93%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 261 P 263
           P
Sbjct: 66  P 66


>At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3
           (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock
           cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis
           thaliana}
          Length = 649

 Score =  157 bits (380), Expect = 1e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDLGGG
Sbjct: 150 VPAYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDLGGG 209

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 210 TFDVSLLTIEEGIFEVKATAGDTHLG 235



 Score =  117 bits (281), Expect = 1e-26
 Identities = 55/88 (62%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGG-KPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F D++VQ+D+K WPF + S    KP I V YKGEDK F  EE+
Sbjct: 64  MNPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEI 123

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSM+L KM+E AEAYLG T++NAV+T P
Sbjct: 124 SSMILIKMREIAEAYLGTTIKNAVVTVP 151



 Score =  114 bits (274), Expect = 7e-26
 Identities = 52/61 (85%), Positives = 57/61 (93%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 261 P 263
           P
Sbjct: 66  P 66


>At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein
           GI:425194 [Spinacia oleracea]
          Length = 650

 Score =  156 bits (379), Expect = 1e-38
 Identities = 75/86 (87%), Positives = 81/86 (94%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDLGGG
Sbjct: 150 VPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGG 209

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 210 TFDVSLLTIEEGIFEVKATAGDTHLG 235



 Score =  120 bits (288), Expect = 1e-27
 Identities = 56/88 (63%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGG-KPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR++ D +VQAD  HWPF+VVS  G KP I V +KGE+K F  EE+
Sbjct: 64  MNPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSAEEI 123

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEA+LG  V+NAV+T P
Sbjct: 124 SSMVLIKMREIAEAFLGSPVKNAVVTVP 151



 Score =  116 bits (279), Expect = 2e-26
 Identities = 53/62 (85%), Positives = 58/62 (93%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 261 PT 266
           PT
Sbjct: 66  PT 67


>At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein,
           putative / HSC70, putative / HSP70, putative strong
           similarity to heat shock cognate 70 kd protein 1
           SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)]
          Length = 617

 Score =  154 bits (374), Expect = 5e-38
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 2/86 (2%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDLGGG 681
           VPAYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK T  G +NVLIFDLGGG
Sbjct: 150 VPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGIKNVLIFDLGGG 209

Query: 682 TFDVSILTIEDGIFEVKSTAGDTHFG 759
           TFDVS+LTIE+GIFEVK+TAGDTH G
Sbjct: 210 TFDVSLLTIEEGIFEVKATAGDTHLG 235



 Score =  120 bits (289), Expect = 1e-27
 Identities = 56/88 (63%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP NT+FDAKRLIGR+F DA+VQ+DMK WPF+V      KP I V YKGE+K F  EE+
Sbjct: 64  MNPVNTVFDAKRLIGRRFSDASVQSDMKFWPFKVTPGQADKPMIFVNYKGEEKQFAAEEI 123

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           SSMVL KM+E AEAYLG +++NAV+T P
Sbjct: 124 SSMVLIKMREIAEAYLGSSIKNAVVTVP 151



 Score =  114 bits (274), Expect = 7e-26
 Identities = 52/61 (85%), Positives = 57/61 (93%)
 Frame = +3

Query: 81  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*T 260
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVA  
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 261 P 263
           P
Sbjct: 66  P 66


>At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 613

 Score =  149 bits (361), Expect = 2e-36
 Identities = 69/84 (82%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGTF
Sbjct: 178 VPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTF 236

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV ST GDTH G
Sbjct: 237 DVSVLTIDNGVFEVLSTNGDTHLG 260



 Score =  116 bits (280), Expect = 1e-26
 Identities = 55/88 (62%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEV 430
           VNP  T+FD KRLIGRKFED  VQ D K  P+++V+  GKP I+V  K GE K F PEE+
Sbjct: 92  VNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEI 151

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+M+LTKMKETAEAYLGK +++AV+T P
Sbjct: 152 SAMILTKMKETAEAYLGKKIKDAVVTVP 179



 Score = 98.3 bits (234), Expect = 5e-21
 Identities = 44/57 (77%), Positives = 51/57 (89%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A  P
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP 94


>At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 668

 Score =  149 bits (361), Expect = 2e-36
 Identities = 69/84 (82%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGTF
Sbjct: 178 VPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTF 236

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV ST GDTH G
Sbjct: 237 DVSVLTIDNGVFEVLSTNGDTHLG 260



 Score =  116 bits (280), Expect = 1e-26
 Identities = 55/88 (62%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEV 430
           VNP  T+FD KRLIGRKFED  VQ D K  P+++V+  GKP I+V  K GE K F PEE+
Sbjct: 92  VNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEI 151

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+M+LTKMKETAEAYLGK +++AV+T P
Sbjct: 152 SAMILTKMKETAEAYLGKKIKDAVVTVP 179



 Score = 98.3 bits (234), Expect = 5e-21
 Identities = 44/57 (77%), Positives = 51/57 (89%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A  P
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP 94


>At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)
           SWISS-PROT:Q9LKR3 PMID:8888624
          Length = 669

 Score =  149 bits (361), Expect = 2e-36
 Identities = 69/84 (82%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GLNV RIINEPTAAAIAYGLDKKG GE+N+L+FDLGGGTF
Sbjct: 178 VPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKG-GEKNILVFDLGGGTF 236

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+LTI++G+FEV ST GDTH G
Sbjct: 237 DVSVLTIDNGVFEVLSTNGDTHLG 260



 Score =  116 bits (280), Expect = 1e-26
 Identities = 55/88 (62%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEV 430
           VNP  T+FD KRLIGRKFED  VQ D K  P+++V+  GKP I+V  K GE K F PEE+
Sbjct: 92  VNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEI 151

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
           S+M+LTKMKETAEAYLGK +++AV+T P
Sbjct: 152 SAMILTKMKETAEAYLGKKIKDAVVTVP 179



 Score = 98.3 bits (234), Expect = 5e-21
 Identities = 44/57 (77%), Positives = 51/57 (89%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A  P
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP 94


>At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)
           Similar to Arabidopsis luminal binding protein
           (gb|D89342); contains Pfam domain PF00012: dnaK protein
          Length = 678

 Score =  147 bits (357), Expect = 6e-36
 Identities = 68/84 (80%), Positives = 78/84 (92%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GLNV+RIINEPT AAIAYGLDKKG GE N+L++DLGGGTF
Sbjct: 192 VPAYFNDAQRQATKDAGAIAGLNVVRIINEPTGAAIAYGLDKKG-GESNILVYDLGGGTF 250

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSILTI++G+FEV ST+GDTH G
Sbjct: 251 DVSILTIDNGVFEVLSTSGDTHLG 274



 Score =  120 bits (288), Expect = 1e-27
 Identities = 55/86 (63%), Positives = 69/86 (80%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP  TIFD KRLIGRKF+D  VQ D+K  P++VV+  GKP I+V  KGE+K F PEE+S+
Sbjct: 108 NPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVKGEEKLFSPEEISA 167

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
           M+LTKMKETAEA+LGK +++AVIT P
Sbjct: 168 MILTKMKETAEAFLGKKIKDAVITVP 193



 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 45/57 (78%), Positives = 50/57 (87%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TP 263
           +GIDLGTTYSCVGV+ +  VEIIANDQGNR TPS+VAFTDTERLIG+AAKNQ A  P
Sbjct: 53  IGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAAKNP 109


>At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein 70
           [Arabidopsis thaliana] GI:6746592; similar to heat shock
           70 protein - Spinacia oleracea,PID:g2654208
          Length = 718

 Score =  130 bits (314), Expect = 1e-30
 Identities = 60/84 (71%), Positives = 70/84 (83%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG D+K      +L+FDLGGGTF
Sbjct: 218 VPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFDRK--ANETILVFDLGGGTF 275

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + DG+FEV ST+GDTH G
Sbjct: 276 DVSVLEVGDGVFEVLSTSGDTHLG 299



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 30/69 (43%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 72  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 248
           ++     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + +RL+G  AK Q
Sbjct: 74  RVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSGDRLVGQIAKRQ 133

Query: 249 VA*TPTTQY 275
               P   +
Sbjct: 134 AVVNPENTF 142



 Score = 58.8 bits (136), Expect = 4e-09
 Identities = 34/87 (39%), Positives = 45/87 (51%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           VNP NT F  KR IGRK  +  V  + K   + VV D     +K+     +K F  EE+S
Sbjct: 136 VNPENTFFSVKRFIGRKMNE--VDEESKQVSYRVVRDENN-NVKLECPAINKQFAAEEIS 192

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL K+ + A  +L   V  AVIT P
Sbjct: 193 AQVLRKLVDDASRFLNDKVTKAVITVP 219


>At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746592
          Length = 718

 Score =  128 bits (310), Expect = 3e-30
 Identities = 59/84 (70%), Positives = 70/84 (83%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFNDSQR ATKDAG I+GL VLRIINEPTAA++AYG ++K      +L+FDLGGGTF
Sbjct: 218 VPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFERK--SNETILVFDLGGGTF 275

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L + DG+FEV ST+GDTH G
Sbjct: 276 DVSVLEVGDGVFEVLSTSGDTHLG 299



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 30/69 (43%), Positives = 40/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query: 72  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 248
           ++     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + +RL+G  AK Q
Sbjct: 74  RVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSKDRLVGQIAKRQ 133

Query: 249 VA*TPTTQY 275
               P   +
Sbjct: 134 AVVNPENTF 142



 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 32/87 (36%), Positives = 44/87 (50%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVS 433
           VNP NT F  KR IGR+  +  V  + K   + V+ D     +K+      K F  EE+S
Sbjct: 136 VNPENTFFSVKRFIGRRMNE--VAEESKQVSYRVIKDENG-NVKLDCPAIGKQFAAEEIS 192

Query: 434 SMVLTKMKETAEAYLGKTVQNAVITFP 514
           + VL K+ + A  +L   V  AVIT P
Sbjct: 193 AQVLRKLVDDASRFLNDKVTKAVITVP 219


>At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial,
           putative / HSP70, mitochondrial, putative strong
           similarity to SP|Q01899 Heat shock 70 kDa protein,
           mitochondrial precursor {Phaseolus vulgaris}
          Length = 682

 Score =  120 bits (290), Expect = 8e-28
 Identities = 58/84 (69%), Positives = 69/84 (82%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG++ K   E  + +FDLGGGTF
Sbjct: 192 VPAYFNDAQRQATKDAGKIAGLDVQRIINEPTAAALSYGMNNK---EGVIAVFDLGGGTF 248

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVSIL I  G+FEVK+T GDT  G
Sbjct: 249 DVSILEISSGVFEVKATNGDTFLG 272



 Score = 85.4 bits (202), Expect = 4e-17
 Identities = 41/86 (47%), Positives = 56/86 (65%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NTIF +KRLIGR+F+D   Q +MK  P+++V     P      +   + F P ++ +
Sbjct: 111 NPTNTIFGSKRLIGRRFDDPQTQKEMKMVPYKIVK---APNGDAWVEANGQKFSPSQIGA 167

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            VLTKMKETAEAYLGK++  AV+T P
Sbjct: 168 NVLTKMKETAEAYLGKSINKAVVTVP 193



 Score = 56.8 bits (131), Expect = 1e-08
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVA*TPT 266
           +GIDLGTT SCV V +     +I N +G+RTTPS VA     E L+G  AK Q    PT
Sbjct: 55  IGIDLGTTNSCVSVMEGKTARVIENAEGSRTTPSVVAMNQKGELLVGTPAKRQAVTNPT 113


>At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746590
          Length = 682

 Score =  119 bits (287), Expect = 2e-27
 Identities = 57/84 (67%), Positives = 69/84 (82%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTF 687
           VPAYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG+  K   E  + +FDLGGGTF
Sbjct: 197 VPAYFNDAQRQATKDAGRIAGLDVERIINEPTAAALSYGMTNK---EGLIAVFDLGGGTF 253

Query: 688 DVSILTIEDGIFEVKSTAGDTHFG 759
           DVS+L I +G+FEVK+T GDT  G
Sbjct: 254 DVSVLEISNGVFEVKATNGDTFLG 277



 Score = 81.4 bits (192), Expect = 6e-16
 Identities = 39/86 (45%), Positives = 54/86 (62%)
 Frame = +2

Query: 257 NPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 436
           NP NT+   KRLIGRKF+D   Q +MK  P+++V     P      +   + + P ++ +
Sbjct: 116 NPTNTVSGTKRLIGRKFDDPQTQKEMKMVPYKIVR---APNGDAWVEANGQQYSPSQIGA 172

Query: 437 MVLTKMKETAEAYLGKTVQNAVITFP 514
            +LTKMKETAEAYLGK+V  AV+T P
Sbjct: 173 FILTKMKETAEAYLGKSVTKAVVTVP 198



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 34/70 (48%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = +3

Query: 72  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQ 248
           K A    +GIDLGTT SCV V +    ++I N +G RTTPS VAF T  E L+G  AK Q
Sbjct: 53  KPAGNDVIGIDLGTTNSCVAVMEGKNPKVIENAEGARTTPSVVAFNTKGELLVGTPAKRQ 112

Query: 249 VA*TPTTQYS 278
               PT   S
Sbjct: 113 AVTNPTNTVS 122


>At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam
           profile: PF00012 Heat shock hsp70 proteins; similar to
           heat-shock proteins GB:CAA94389, GB:AAD55461
           [Arabidopsis thaliana]
          Length = 831

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL---DKKGTGERNVLI 663
           +C   +P YF D QR+A  DA TI+GL+ LR+I+E TA A+AYG+   D   + + NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHETTATALAYGIYKTDLPESDQLNVAF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G  +  V I   + G  ++ S A D   G
Sbjct: 199 IDIGHASMQVCIAGFKKGQLKILSHAFDRSLG 230



 Score = 67.3 bits (157), Expect = 1e-11
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP N+I   KRLIGR+F D  +Q D+K  PF V     G P I   Y GE + F P +V
Sbjct: 58  MNPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQV 117

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
             M+L+ +K  AE  L   V +  I  P
Sbjct: 118 MGMMLSNLKGIAEKNLNTAVVDCCIGIP 145



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 21/62 (33%), Positives = 29/62 (46%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTTQ 272
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A        P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 273 YS 278
            S
Sbjct: 64  IS 65


>At1g11660.1 68414.m01339 heat shock protein, putative strong
           similarity to gb|Z70314 heat-shock protein from
           Arabidopsis thaliana and is a member of the PF|00012
           Hsp70 protein family
          Length = 773

 Score = 68.5 bits (160), Expect = 4e-12
 Identities = 35/88 (39%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEV 430
           ++P +TI   KRLIGRKF +  VQ D++ +PFE   D  G  +I++ Y GE ++F P ++
Sbjct: 58  MHPKSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQI 117

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
             M+L+ +K+ AE  L   V + VI  P
Sbjct: 118 LGMLLSHLKQIAEKSLKTPVSDCVIGIP 145



 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 31/94 (32%), Positives = 51/94 (54%), Gaps = 4/94 (4%)
 Frame = +1

Query: 490 AECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDK----KGTGERNV 657
           ++C   +P+YF +SQR A  DA  I+GL  LR++++ TA A+ YG+ K      +    +
Sbjct: 138 SDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATALGYGIYKTDLVANSSPTYI 197

Query: 658 LIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
           +  D+G     V + + E G   V+S A D + G
Sbjct: 198 VFIDIGHCDTQVCVASFESGSMRVRSHAFDRNLG 231



 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/49 (32%), Positives = 29/49 (59%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAA 239
           VG D+G     + V +   ++++ ND+ NR  P+ V+F + +R +G AA
Sbjct: 4   VGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAA 52


>At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 663
           +C   +P YF D QR+A  DA TI+GL+ L +I+E TA A+AYG+ K    E    NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALAYGIYKTDLPENDQLNVAF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G  +  V I   + G  ++ S A D   G
Sbjct: 199 IDIGHASMQVCIAGFKKGQLKILSHAFDRSLG 230



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP N+I   KRLIGR+F D  +Q D+K  PF V     G P I   Y GE + F P +V
Sbjct: 58  MNPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQV 117

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
             M+L+ +K  AE  L   V +  I  P
Sbjct: 118 MGMMLSNLKGIAEKNLNTAVVDCCIGIP 145



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 21/62 (33%), Positives = 29/62 (46%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTTQ 272
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A        P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 273 YS 278
            S
Sbjct: 64  IS 65


>At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 66.9 bits (156), Expect = 1e-11
 Identities = 36/92 (39%), Positives = 50/92 (54%), Gaps = 3/92 (3%)
 Frame = +1

Query: 493 ECSYHVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGER---NVLI 663
           +C   +P YF D QR+A  DA TI+GL+ L +I+E TA A+AYG+ K    E    NV  
Sbjct: 139 DCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHETTATALAYGIYKTDLPENDQLNVAF 198

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAGDTHFG 759
            D+G  +  V I   + G  ++ S A D   G
Sbjct: 199 IDIGHASMQVCIAGFKKGQLKILSHAFDRSLG 230



 Score = 66.5 bits (155), Expect = 2e-11
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 1/88 (1%)
 Frame = +2

Query: 254 VNPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEV 430
           +NP N+I   KRLIGR+F D  +Q D+K  PF V     G P I   Y GE + F P +V
Sbjct: 58  MNPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQV 117

Query: 431 SSMVLTKMKETAEAYLGKTVQNAVITFP 514
             M+L+ +K  AE  L   V +  I  P
Sbjct: 118 MGMMLSNLKGIAEKNLNTAVVDCCIGIP 145



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 21/62 (33%), Positives = 29/62 (46%)
 Frame = +3

Query: 93  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA*TPTTQ 272
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A        P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 273 YS 278
            S
Sbjct: 64  IS 65


>At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70,
           putative
          Length = 867

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 1/60 (1%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLGGGT 684
           VP YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+G  +
Sbjct: 169 VPPYFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGSSS 228



 Score = 35.1 bits (77), Expect = 0.051
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +3

Query: 78  AKAPAVGIDLGTTYSCVGV--FQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 245
           +++  + +DLG+ +  V V   + G+  + +  N+   R +P+ VAF   +RL+G+ A  
Sbjct: 22  SESAVLSVDLGSEWVKVAVVNLKRGQSPISVAINEMSKRKSPALVAFQSGDRLLGEEAAG 81

Query: 246 QVA*TPTTQYS 278
             A  P   YS
Sbjct: 82  ITARYPNKVYS 92



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 21/103 (20%), Positives = 45/103 (43%), Gaps = 3/103 (2%)
 Frame = +2

Query: 215 RASHRRCRQEPGGVN---PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIK 385
           ++  R   +E  G+    PN      + ++G+ F+      D  + PF++V D  +  + 
Sbjct: 69  QSGDRLLGEEAAGITARYPNKVYSQLRDMVGKPFKHVKDFIDSVYLPFDIVED-SRGAVG 127

Query: 386 VAYKGEDKTFFPEEVSSMVLTKMKETAEAYLGKTVQNAVITFP 514
           +        +  EE+ +M+L      AE +    V++ V++ P
Sbjct: 128 IKIDDGSTVYSVEELLAMILGYASNLAEFHAKIPVKDMVVSVP 170


>At2g32120.2 68415.m03926 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 8/87 (9%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLI 663
           VP  F+  Q    + A  ++GL+VLR++ EPTA A+ Y         D  G+G ER  +I
Sbjct: 173 VPVSFSRFQLTRFERACAMAGLHVLRLMPEPTAIALLYAQQQQMTTHDNMGSGSERLAVI 232

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAG 744
           F++G G  DV++     G+ ++K+ AG
Sbjct: 233 FNMGAGYCDVAVTATAGGVSQIKALAG 259



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = +2

Query: 272 IFDAKRLIGRKFEDATVQADMKHWPF--EVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 445
           IF+ KRL+GR   D  V A  K+ PF  + +  G +P I        ++  PEEV ++ L
Sbjct: 93  IFNMKRLVGRVDTDPVVHAS-KNLPFLVQTLDIGVRPFIAALVNNAWRSTTPEEVLAIFL 151

Query: 446 TKMKETAEAYLGKTVQNAVITFP 514
            +++  AEA L + V+N V+T P
Sbjct: 152 VELRLMAEAQLKRPVRNVVLTVP 174



 Score = 34.3 bits (75), Expect = 0.089
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 212
           A+GID+GT+   + V+   +V I+ N +  +   S+V F D
Sbjct: 30  ALGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFKD 70


>At2g32120.1 68415.m03925 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 51.6 bits (118), Expect = 5e-07
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 8/87 (9%)
 Frame = +1

Query: 508 VPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLI 663
           VP  F+  Q    + A  ++GL+VLR++ EPTA A+ Y         D  G+G ER  +I
Sbjct: 173 VPVSFSRFQLTRFERACAMAGLHVLRLMPEPTAIALLYAQQQQMTTHDNMGSGSERLAVI 232

Query: 664 FDLGGGTFDVSILTIEDGIFEVKSTAG 744
           F++G G  DV++     G+ ++K+ AG
Sbjct: 233 FNMGAGYCDVAVTATAGGVSQIKALAG 259



 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 2/83 (2%)
 Frame = +2

Query: 272 IFDAKRLIGRKFEDATVQADMKHWPF--EVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 445
           IF+ KRL+GR   D  V A  K+ PF  + +  G +P I        ++  PEEV ++ L
Sbjct: 93  IFNMKRLVGRVDTDPVVHAS-KNLPFLVQTLDIGVRPFIAALVNNAWRSTTPEEVLAIFL 151

Query: 446 TKMKETAEAYLGKTVQNAVITFP 514
            +++  AEA L + V+N V+T P
Sbjct: 152 VELRLMAEAQLKRPVRNVVLTVP 174



 Score = 34.3 bits (75), Expect = 0.089
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 90  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 212
           A+GID+GT+   + V+   +V I+ N +  +   S+V F D
Sbjct: 30  ALGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFKD 70


>At5g41310.1 68418.m05020 kinesin motor protein-related 
          Length = 961

 Score = 31.9 bits (69), Expect = 0.48
 Identities = 30/134 (22%), Positives = 58/134 (43%), Gaps = 1/134 (0%)
 Frame = +2

Query: 161  RQRPGQQDHSVLCCVHRHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFEDATVQADMKH 340
            RQ PG    +    +HRH+   R   +  GG   NN IF+   L+G  FE++  +  +  
Sbjct: 806  RQGPGLLGRTT-SDIHRHQNESRSSSKFSGGAKDNN-IFEDTELLG--FEESNNEERLSD 861

Query: 341  WPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVLTKMKE-TAEAYLGKTVQNAVITFPR 517
                 +S G +    ++    + T FPE  +   + +  E   +A++G      +   P+
Sbjct: 862  ISDSCLSMGTETDGSISSGAMELTLFPETSNPPEMFEQSEQNDKAHVGVGPSKPLKHTPK 921

Query: 518  TSMTLKDKPQKMQV 559
              ++   KP ++ +
Sbjct: 922  PDIS---KPSRLSI 932


>At4g24910.1 68417.m03566 hypothetical protein contains Pfam profile
           PF04669: Protein of unknown function (DUF579)
          Length = 315

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = -1

Query: 198 HKTEWSCCPGRWR*SPPSRAG--RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQL 31
           H++  S      R SPPS     +HQR ST    +F +R L+P  IF  S    L+ L
Sbjct: 6   HQSSLSILNPLLRFSPPSSPDNPKHQRLSTIKMPKFTVRKLIPLLIFVLSSLSVLRLL 63


>At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product
           [Arabidopsis thaliana] GI:871782
          Length = 748

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +1

Query: 112 PRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMP-PRTRWREPQ 264
           PRT    S++TGR   +P TR   P     R ++P      P PR++  EPQ
Sbjct: 272 PRTPIHESAATGRRPQTPETR---PRTAQRRGRSPEFMERSPGPRSKTPEPQ 320


>At5g62550.1 68418.m07850 expressed protein 
          Length = 487

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 19/65 (29%), Positives = 30/65 (46%)
 Frame = -1

Query: 483 LPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCFMSACTVASSN 304
           +PR A  VS +  ST  L  SGKK +         L +P   T++     +S+   + S 
Sbjct: 47  MPRRARVVSAVSQSTTVLDLSGKKSVDRTKLPPRRLSIPNKPTSNSSVKSVSSSVTSLSE 106

Query: 303 LRPMR 289
           ++P R
Sbjct: 107 VKPKR 111


>At2g21380.1 68415.m02544 kinesin motor protein-related
          Length = 1058

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 18/51 (35%), Positives = 29/51 (56%)
 Frame = -1

Query: 717 TILDGKDGHVEGTAAEVKDKYISFSSTLFVKTVSNRSSSRFIDDSENVQAR 565
           +I  GKD  ++    +  D   S SSTL + + + RSSS+F D++  V +R
Sbjct: 527 SISAGKDDKLDSLLLD-SDNLASPSSTLSLASDARRSSSKFKDENSPVGSR 576


>At3g11330.1 68416.m01378 leucine-rich repeat family protein
          Length = 499

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
 Frame = -2

Query: 731 FTSKIPSSMVRMDTSKVPPPRSKISTFR--SPVPFLSRP*AIAAAVGSL 591
           FT+K PSS V     + PPP S  S+    + +P L++P  +A+   ++
Sbjct: 23  FTAKSPSSSVPPFDIEQPPPSSSSSSIEIVTQMPHLTQPDVLASMTSAI 71


>At2g27350.5 68415.m03295 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 388

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 88  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 246
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.4 68415.m03294 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 388

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 88  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 246
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.3 68415.m03293 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 506

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 88  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 246
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.2 68415.m03292 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 88  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 246
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.1 68415.m03291 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 28.7 bits (61), Expect = 4.4
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 88  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 246
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At4g34940.1 68417.m04953 armadillo/beta-catenin repeat family
           protein contains Pfam profile: PF00514
           armadillo/beta-catenin-like repeat
          Length = 664

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 12/44 (27%), Positives = 21/44 (47%)
 Frame = +2

Query: 206 HRHRASHRRCRQEPGGVNPNNTIFDAKRLIGRKFEDATVQADMK 337
           ++   +H +    P G NP +       + GR++ED   +A MK
Sbjct: 378 NQQHQNHTKGGSNPRGNNPTHVSLMGTSIKGREYEDPATKAQMK 421


>At4g27630.2 68417.m03972 expressed protein
          Length = 467

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = -1

Query: 135 RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLSKR 22
           R  R   W  D F L VLL F +    CYL L+    R
Sbjct: 71  REARMVNWKVDLFCLIVLLVFMLPYYHCYLMLRNTGVR 108


>At1g06850.1 68414.m00730 bZIP transcription factor, putative
           contains Pfam profile: PF00170 bZIP transcription factor
          Length = 337

 Score = 27.9 bits (59), Expect = 7.7
 Identities = 15/27 (55%), Positives = 15/27 (55%)
 Frame = +2

Query: 662 SLTSAAVPSTCPSLPSRMVSSR*NPPP 742
           SLTS   P   PSL S  VS   NPPP
Sbjct: 78  SLTSNPNPFQNPSLSSNSVSGAANPPP 104


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,303,981
Number of Sequences: 28952
Number of extensions: 416574
Number of successful extensions: 1431
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 1301
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1400
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1692519896
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -