SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20054
         (677 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g33500.1 68414.m04146 hypothetical protein                          32   0.30 
At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)...    25   1.5  
At4g23560.1 68417.m03394 glycosyl hydrolase family 9 protein sim...    29   2.1  
At3g24740.1 68416.m03106 expressed protein                             29   2.1  
At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase fa...    29   2.8  
At5g43680.1 68418.m05339 expressed protein                             27   8.6  
At5g01150.1 68418.m00019 hypothetical protein contains Pfam prof...    27   8.6  

>At1g33500.1 68414.m04146 hypothetical protein
          Length = 254

 Score = 32.3 bits (70), Expect = 0.30
 Identities = 24/88 (27%), Positives = 45/88 (51%)
 Frame = +2

Query: 26  AIKHQIEKGVVDAITHEARYSLSEEKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDCDSI 205
           +++ Q++   +  +  +  ++LSE K LKE+ D +T T   +     EK Q K+   +S 
Sbjct: 26  SVEEQMQVTTISTLEKDLEHALSETKRLKEETDQKTRTRGEICSHILEK-QRKISSMESD 84

Query: 206 SQVKSKILDALFKNTPFHSDLLSMKLIS 289
           S   ++ L+ + +      D LS KL+S
Sbjct: 85  SVNIAQSLELILQ----ERDSLSAKLVS 108


>At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)
           Similar to Arabidopsis luminal binding protein
           (gb|D89342); contains Pfam domain PF00012: dnaK protein
          Length = 678

 Score = 25.4 bits (53), Expect(2) = 1.5
 Identities = 10/36 (27%), Positives = 23/36 (63%)
 Frame = +2

Query: 98  EKLLKEQIDYQTVTLHIVQDEFDEKVQCKVLDCDSI 205
           E +LKE +++    ++  ++++DEK++   L CD +
Sbjct: 617 EGVLKEALEWLEENVNAEKEDYDEKLKEVELVCDPV 652



 Score = 23.0 bits (47), Expect(2) = 1.5
 Identities = 9/31 (29%), Positives = 19/31 (61%)
 Frame = +2

Query: 32  KHQIEKGVVDAITHEARYSLSEEKLLKEQID 124
           K ++ +  ++ +  EA     E+K++KE+ID
Sbjct: 552 KGRLTEEEIEEMIREAEEFAEEDKIMKEKID 582


>At4g23560.1 68417.m03394 glycosyl hydrolase family 9 protein
           similar to cellulase GI:1039431 from [Phaseolus
           vulgaris]
          Length = 479

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
 Frame = +3

Query: 504 YTVYNSDITDQNVHYYHLV-KPIEYQHIVNKSSEHSHKAIPEIFLTGCYL 650
           Y+ YNSD  + NVH   +V  P       +K S++SH A P  ++   ++
Sbjct: 420 YSYYNSDTPNPNVHIGAIVGGPNSSDQYSDKKSDYSH-AEPTTYINAAFI 468


>At3g24740.1 68416.m03106 expressed protein
          Length = 354

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 15/41 (36%), Positives = 17/41 (41%)
 Frame = +1

Query: 295 RHGRGGHVTLQDEDVTTKTLNGWRKLNTLAHYGVKESAIMS 417
           RH R  H T +  D        WR+L     YG   SAI S
Sbjct: 183 RHARRTHPTTRPSDTDPSRERAWRRLENQREYGDIVSAIRS 223


>At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase
           family protein similar to flavanone 3-hydroxylase
           [Persea americana][GI:727410]; contains PF03171
           2OG-Fe(II) oxygenase superfamily domain
          Length = 341

 Score = 29.1 bits (62), Expect = 2.8
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%)
 Frame = +2

Query: 8   RFLLFKAIKHQIEKGVVDAITHEAR--YSLSEEKLLKEQIDYQTVTLHI 148
           RF  F+ I H + K ++D +   AR  +S+S E+ +K   D  T T  +
Sbjct: 61  RFGFFQVINHGVNKQIIDEMVSVAREFFSMSMEEKMKLYSDDPTKTTRL 109


>At5g43680.1 68418.m05339 expressed protein
          Length = 232

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 56  VDAITHEARYSLSEEKLLKEQIDYQ 130
           VDAI+H AR+SL +   L  ++D Q
Sbjct: 73  VDAISHGARFSLFDSSPLTRRVDNQ 97


>At5g01150.1 68418.m00019 hypothetical protein contains Pfam profile
           PF05056: Protein of unknown function (DUF674)
          Length = 501

 Score = 27.5 bits (58), Expect = 8.6
 Identities = 16/49 (32%), Positives = 26/49 (53%)
 Frame = +2

Query: 176 QCKVLDCDSISQVKSKILDALFKNTPFHSDLLSMKLISSGVMVEVDMLR 322
           +C VLD  +I+ + S     L K    H+D L +++IS      +D+LR
Sbjct: 414 KCTVLDDLTITSMNSCSTVCLLKKLQSHADDLEVQVISISNAEALDLLR 462


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,107,575
Number of Sequences: 28952
Number of extensions: 248384
Number of successful extensions: 610
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 599
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 610
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1428369392
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -