SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20053
         (739 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g79890.1 68414.m09334 helicase-related similar to CHL1 potent...    33   0.26 
At5g27160.1 68418.m03241 hypothetical protein contains Pfam prof...    28   7.4  
At5g10410.1 68418.m01207 epsin N-terminal homology (ENTH) domain...    28   7.4  
At5g19450.2 68418.m02318 calcium-dependent protein kinase 19 (CD...    27   9.8  
At5g19450.1 68418.m02317 calcium-dependent protein kinase 19 (CD...    27   9.8  

>At1g79890.1 68414.m09334 helicase-related similar to CHL1 potential
           helicase protein (GI:2632247) [Homo sapiens]; similar to
           helicase GB:AAB06962 [Homo sapiens]
          Length = 882

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +2

Query: 32  CKRRWTKLYEDIRVKSVT---CRKLKKKKTNILVSIEDVSFPSKILKKTSFSHSVDVL-S 199
           CKRR  + YE++ +K+V     R ++ +K    + + D  + +   K+TS SH  + L  
Sbjct: 785 CKRRGKEYYENLCMKAVNQSIGRAIRHEKDYASILLVDARYSNDPSKRTSHSHPSNKLPK 844

Query: 200 CVKQSVVYPLK 232
            +K  ++Y  K
Sbjct: 845 WIKDRLIYSTK 855


>At5g27160.1 68418.m03241 hypothetical protein contains Pfam profile
           PF03384: Drosophila protein of unknown function, DUF287
          Length = 702

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 10/24 (41%), Positives = 16/24 (66%)
 Frame = +2

Query: 281 RRKSTKLIFLCKILGCKRKKSGSL 352
           R+K   L+FLCK++  K K  G++
Sbjct: 259 RKKLAILLFLCKVIAAKSKADGNI 282


>At5g10410.1 68418.m01207 epsin N-terminal homology (ENTH)
           domain-containing protein / clathrin assembly
           protein-related contains Pfam PF01417: ENTH domain. ENTH
           (Epsin N-terminal homology) domain; similar to clathrin
           assembly protein AP180 (GI:6492344) [Xenopus laevis]
          Length = 338

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 4/51 (7%)
 Frame = -3

Query: 314 YTKILILYSFDEFSMAAFDFA----RTRKTYTSMDKQLIVLHKTIRQRNAK 174
           Y   +I YS   ++ AAF  A    R  K      K LIV+HK I+    K
Sbjct: 55  YVSAVISYSNSRYAPAAFSAALWRLRVTKNAIVATKSLIVIHKLIKSSRDK 105


>At5g19450.2 68418.m02318 calcium-dependent protein kinase 19
           (CDPK19) identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|836942|gb|AAA67655
          Length = 533

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +2

Query: 47  TKLYEDIRV-KSVTCRKLKKKKTNILVSIEDVSFPSKILK 163
           T L  DI+  +   C+ + KKK    V IEDV    +I+K
Sbjct: 71  TYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVEIMK 110


>At5g19450.1 68418.m02317 calcium-dependent protein kinase 19
           (CDPK19) identical to calcium-dependent protein kinase
           [Arabidopsis thaliana] gi|836942|gb|AAA67655
          Length = 533

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)
 Frame = +2

Query: 47  TKLYEDIRV-KSVTCRKLKKKKTNILVSIEDVSFPSKILK 163
           T L  DI+  +   C+ + KKK    V IEDV    +I+K
Sbjct: 71  TYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVEIMK 110


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,100,163
Number of Sequences: 28952
Number of extensions: 239662
Number of successful extensions: 541
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 536
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 541
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1624036432
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -