SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20052
         (684 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g29850.2 68414.m03649 double-stranded DNA-binding family prot...    58   4e-09
At1g29850.1 68414.m03648 double-stranded DNA-binding family prot...    58   4e-09
At5g58350.1 68418.m07306 protein kinase family protein contains ...    27   8.8  
At1g64630.1 68414.m07327 protein kinase family protein contains ...    27   8.8  

>At1g29850.2 68414.m03649 double-stranded DNA-binding family protein
           contains Pfam profile: PF01984 double-stranded
           DNA-binding domain
          Length = 130

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 33/69 (47%), Positives = 43/69 (62%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           AR R+  I L +PEKA  +E++I R AQMGQI  K++E  LI +LE  N Q  K Q+ V 
Sbjct: 62  ARERIARIALVKPEKARGVEDVILRAAQMGQIVEKVSEERLITLLEQINSQTTK-QTKVT 120

Query: 441 FDRRRAALD 467
           + RRR   D
Sbjct: 121 YQRRRGVDD 129


>At1g29850.1 68414.m03648 double-stranded DNA-binding family protein
           contains Pfam profile: PF01984 double-stranded
           DNA-binding domain
          Length = 129

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 33/69 (47%), Positives = 43/69 (62%)
 Frame = +3

Query: 261 ARARLNTIKLGRPEKAAMIENMICRMAQMGQIQCKITEPDLIQILESFNQQMPKSQSTVK 440
           AR R+  I L +PEKA  +E++I R AQMGQI  K++E  LI +LE  N Q  K Q+ V 
Sbjct: 61  ARERIARIALVKPEKARGVEDVILRAAQMGQIVEKVSEERLITLLEQINSQTTK-QTKVT 119

Query: 441 FDRRRAALD 467
           + RRR   D
Sbjct: 120 YQRRRGVDD 128


>At5g58350.1 68418.m07306 protein kinase family protein contains
           protein kinase domain, Pfam:PF00069
          Length = 571

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 10/30 (33%), Positives = 20/30 (66%), Gaps = 2/30 (6%)
 Frame = -1

Query: 102 IHFKAIYRFL--WVTIHNKSINILRKLYIS 19
           ++ K+I RF   W+ +HN ++N + +L+ S
Sbjct: 75  LNHKSIIRFYTSWIDVHNHTLNFITELFTS 104


>At1g64630.1 68414.m07327 protein kinase family protein contains
           eukaryotic protein kinase domain, INTERPRO:IPR000719;
           contains serine/threonine protein kinases active-site
           signature, PROSITE:PS00108
          Length = 524

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = -1

Query: 78  FLWVTIHNKSINILRKLYIS 19
           + WV  HNKSIN++ +L+ S
Sbjct: 82  YSWVDDHNKSINMITELFTS 101


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,395,223
Number of Sequences: 28952
Number of extensions: 221145
Number of successful extensions: 366
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 361
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 366
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -