SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20051
         (781 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p...    99   3e-21
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    56   3e-08
At5g13650.2 68418.m01585 elongation factor family protein contai...    55   6e-08
At1g62750.1 68414.m07082 elongation factor Tu family protein sim...    54   1e-07
At5g13650.1 68418.m01584 elongation factor family protein contai...    53   2e-07
At1g06220.2 68414.m00656 elongation factor Tu family protein sim...    51   7e-07
At1g06220.1 68414.m00655 elongation factor Tu family protein sim...    51   7e-07
At5g08650.1 68418.m01029 GTP-binding protein LepA, putative            50   2e-06
At2g45030.1 68415.m05606 mitochondrial elongation factor, putati...    49   4e-06
At1g45332.1 68414.m05195 mitochondrial elongation factor, putati...    49   4e-06
At5g25230.1 68418.m02991 elongation factor Tu family protein tra...    48   5e-06
At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    48   7e-06
At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide...    46   4e-05
At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ...    32   0.37 
At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ...    32   0.37 
At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ...    32   0.37 
At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ...    32   0.37 
At1g19390.1 68414.m02412 wall-associated kinase, putative simila...    31   0.86 
At3g20280.2 68416.m02570 PHD finger family protein contains Pfam...    31   1.1  
At3g20280.1 68416.m02569 PHD finger family protein contains Pfam...    31   1.1  
At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,...    30   1.5  
At2g27035.1 68415.m03248 plastocyanin-like domain-containing pro...    30   1.5  
At1g17220.1 68414.m02098 translation initiation factor IF-2, chl...    30   1.5  
At5g17810.1 68418.m02088 homeobox-leucine zipper transcription f...    30   2.0  
At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E...    30   2.0  
At3g03660.1 68416.m00369 homeobox-leucine zipper transcription f...    29   3.5  
At1g75800.1 68414.m08805 pathogenesis-related thaumatin family p...    29   3.5  
At1g18485.1 68414.m02307 pentatricopeptide (PPR) repeat-containi...    29   3.5  
At4g11160.1 68417.m01808 translation initiation factor IF-2, mit...    29   4.6  
At3g06620.1 68416.m00769 protein kinase family protein contains ...    29   4.6  
At1g66310.1 68414.m07530 F-box family protein contains F-box dom...    29   4.6  
At4g10070.1 68417.m01647 KH domain-containing protein DNA-direct...    28   8.0  
At1g66300.1 68414.m07529 F-box family protein contains F-box dom...    28   8.0  

>At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2,
           putative similar to ELONGATION FACTOR 2 GB:O14460 from
           [Schizosaccharomyces pombe]
          Length = 843

 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 48/66 (72%), Positives = 53/66 (80%)
 Frame = +1

Query: 58  MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTR 237
           MV FT DE+R +MD K NIRNMSVIAHVDHGKSTLTDSLV+ AGIIA   AG+ R TDTR
Sbjct: 1   MVKFTADELRRIMDYKHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTR 60

Query: 238 KDEQDR 255
            DE +R
Sbjct: 61  ADEAER 66



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 48/103 (46%), Positives = 64/103 (62%), Gaps = 1/103 (0%)
 Frame = +2

Query: 461 CVWCVCTN*NSTA-SGYAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIA 637
           C+  VC    +       ERI+P+L +NKMDR            YQTF R++EN NVI+A
Sbjct: 131 CIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFSRVIENANVIMA 190

Query: 638 TYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYAT 766
           TY D    +G+V+V P KG+V F +GLHGWAFTL  F++MYA+
Sbjct: 191 TYEDP--LLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYAS 231



 Score = 89.8 bits (213), Expect = 2e-18
 Identities = 49/84 (58%), Positives = 60/84 (71%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           ITIKST IS+++E+ ++ L   T    R+ +E  +LINLIDSPGHVDFSSEVTAALR+TD
Sbjct: 68  ITIKSTGISLYYEMTDESLKSFTGA--RDGNE--YLINLIDSPGHVDFSSEVTAALRITD 123

Query: 438 GALXXXXXXXXXXXQTETVLRQAM 509
           GAL           QTETVLRQA+
Sbjct: 124 GALVVVDCIEGVCVQTETVLRQAL 147


>At3g22980.1 68416.m02898 elongation factor Tu family protein
           similar to eukaryotic translation elongation factor 2
           GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 27/51 (52%), Positives = 33/51 (64%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQA 506
           K + +NLIDSPGH+DF SEV+ A R++DGAL           QT  VLRQA
Sbjct: 72  KDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEGVHIQTHAVLRQA 122



 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 31/70 (44%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLV--SKAGIIAGARAGETRFTDTRKDEQDRASPLNLRP 279
           R +RN+ ++AHVDHGK+TL D L+  S  G++    AG+ RF D   +EQ RA  + ++ 
Sbjct: 7   RKVRNICILAHVDHGKTTLADHLIASSGGGVLHPRLAGKLRFMDYLDEEQRRA--ITMKS 64

Query: 280 SLCSSSLKRK 309
           S  S SLK K
Sbjct: 65  S--SISLKYK 72



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 30/111 (27%), Positives = 45/111 (40%), Gaps = 24/111 (21%)
 Frame = +2

Query: 506 YAERIKPILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDD----------G 655
           + E++ P L +NK+DR            Y    RIV  VN I++ Y  +           
Sbjct: 123 WIEKLTPCLVLNKIDRLIFELRLSPMEAYTRLIRIVHEVNGIVSAYKSEKYLSDVDSILA 182

Query: 656 GPMGEVRVD--------------PSKGSVGFGSGLHGWAFTLKQFSEMYAT 766
            P GE+  +              P KG+V F   L GW F + +F+  YA+
Sbjct: 183 SPSGELSAESLELLEDDEEVTFQPQKGNVVFVCALDGWGFGIAEFANFYAS 233


>At5g13650.2 68418.m01585 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 676

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 23/69 (33%), Positives = 44/69 (63%)
 Frame = +1

Query: 49  PSKMVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFT 228
           PS     +V+  +  +D++ N+RN++++AHVDHGK+TL DS++ +A +    +  + R  
Sbjct: 62  PSTAEPASVEVKKKQLDRRDNVRNIAIVAHVDHGKTTLVDSMLRQAKVFRDNQVMQERIM 121

Query: 229 DTRKDEQDR 255
           D+   E++R
Sbjct: 122 DSNDLERER 130



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K   +N+ID+PGH DF  EV   L + DG L           QT  VL++A+
Sbjct: 144 KNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMPQTRFVLKKAL 195


>At1g62750.1 68414.m07082 elongation factor Tu family protein
           similar to elongation factor G SP:P34811 [Glycine max
           (Soybean)]
          Length = 783

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 33/80 (41%), Positives = 45/80 (56%)
 Frame = +3

Query: 267 KSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           + TA   + E E++  + IT+       +K   IN+ID+PGHVDF+ EV  ALRV DGA+
Sbjct: 131 EGTATMDWMEQEQERGITITSAATTTFWDK-HRINIIDTPGHVDFTLEVERALRVLDGAI 189

Query: 447 XXXXXXXXXXXQTETVLRQA 506
                      Q+ETV RQA
Sbjct: 190 CLFDSVAGVEPQSETVWRQA 209



 Score = 30.3 bits (65), Expect = 1.5
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%)
 Frame = +1

Query: 106 RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGE----TRFTDTRKDEQDR 255
           ++ RN+ ++AH+D GK+T T+ ++   G     + GE    T   D  + EQ+R
Sbjct: 94  KDYRNIGIMAHIDAGKTTTTERILYYTG--RNYKIGEVHEGTATMDWMEQEQER 145


>At5g13650.1 68418.m01584 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 675

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 20/54 (37%), Positives = 38/54 (70%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           +D++ N+RN++++AHVDHGK+TL DS++ +A +    +  + R  D+   E++R
Sbjct: 76  LDRRDNVRNIAIVAHVDHGKTTLVDSMLRQAKVFRDNQVMQERIMDSNDLERER 129



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/52 (38%), Positives = 27/52 (51%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           K   +N+ID+PGH DF  EV   L + DG L           QT  VL++A+
Sbjct: 143 KNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMPQTRFVLKKAL 194


>At1g06220.2 68414.m00656 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +   K +L N++D+PGHV+FS E+TA+LR+ DGA+            TE  +R A+
Sbjct: 203 DSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEGVMVNTERAIRHAI 258



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 25/79 (31%), Positives = 42/79 (53%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGF 706
           ++ +NK+DR            Y   +  +E +N  I+  +   G +    +DP+ G+V F
Sbjct: 265 VVVINKVDRLITELKLPPRDAYYKLRHTIEVINNHISAASTTAGDLP--LIDPAAGNVCF 322

Query: 707 GSGLHGWAFTLKQFSEMYA 763
            SG  GW+FTL+ F++MYA
Sbjct: 323 ASGTAGWSFTLQSFAKMYA 341



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = +1

Query: 88  GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARA---GETRFTDTRKDEQDR 255
           G+M     +RN++++ H+ HGK+   D LV +   ++   A      ++TDTR DEQ+R
Sbjct: 130 GLMSNPALVRNVALVGHLQHGKTVFMDMLVEQTHHMSTFNAKNEKHMKYTDTRVDEQER 188


>At1g06220.1 68414.m00655 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +   K +L N++D+PGHV+FS E+TA+LR+ DGA+            TE  +R A+
Sbjct: 203 DSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEGVMVNTERAIRHAI 258



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 25/79 (31%), Positives = 42/79 (53%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGF 706
           ++ +NK+DR            Y   +  +E +N  I+  +   G +    +DP+ G+V F
Sbjct: 265 VVVINKVDRLITELKLPPRDAYYKLRHTIEVINNHISAASTTAGDLP--LIDPAAGNVCF 322

Query: 707 GSGLHGWAFTLKQFSEMYA 763
            SG  GW+FTL+ F++MYA
Sbjct: 323 ASGTAGWSFTLQSFAKMYA 341



 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = +1

Query: 88  GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARA---GETRFTDTRKDEQDR 255
           G+M     +RN++++ H+ HGK+   D LV +   ++   A      ++TDTR DEQ+R
Sbjct: 130 GLMSNPALVRNVALVGHLQHGKTVFMDMLVEQTHHMSTFNAKNEKHMKYTDTRVDEQER 188


>At5g08650.1 68418.m01029 GTP-binding protein LepA, putative
          Length = 681

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 24/56 (42%), Positives = 34/56 (60%)
 Frame = +1

Query: 109 NIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRASPLNLR 276
           NIRN S+IAH+DHGKSTL D L+   G +   R  + +F D    E++R   + L+
Sbjct: 85  NIRNFSIIAHIDHGKSTLADKLLQVTGTVQN-RDMKEQFLDNMDLERERGITIKLQ 139



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 18/29 (62%), Positives = 23/29 (79%)
 Frame = +3

Query: 360 FLINLIDSPGHVDFSSEVTAALRVTDGAL 446
           F +NLID+PGHVDFS EV+ +L   +GAL
Sbjct: 152 FCLNLIDTPGHVDFSYEVSRSLAACEGAL 180


>At2g45030.1 68415.m05606 mitochondrial elongation factor, putative
           similar to SP|P25039 Elongation factor G 1,
           mitochondrial precursor (mEF-G-1) {Saccharomyces
           cerevisiae}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03764: Elongation factor
           G domain IV, PF00679: Elongation factor G C-terminus
          Length = 754

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           K + +N+ID+PGHVDF+ EV  ALRV DGA+           Q+ TV RQ
Sbjct: 131 KDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQ 180



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           MDK   +RN+ + AH+D GK+TLT+ ++   G I
Sbjct: 62  MDK---LRNIGISAHIDSGKTTLTERVLFYTGRI 92


>At1g45332.1 68414.m05195 mitochondrial elongation factor, putative
           similar to mitochondrial elongation factor GI:3917 from
           [Saccharomyces cerevisiae]
          Length = 754

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 24/50 (48%), Positives = 31/50 (62%)
 Frame = +3

Query: 354 KGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQ 503
           K + +N+ID+PGHVDF+ EV  ALRV DGA+           Q+ TV RQ
Sbjct: 131 KDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSITVDRQ 180



 Score = 31.5 bits (68), Expect = 0.65
 Identities = 15/34 (44%), Positives = 23/34 (67%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGII 195
           MDK   +RN+ + AH+D GK+TLT+ ++   G I
Sbjct: 62  MDK---LRNIGISAHIDSGKTTLTERVLFYTGRI 92


>At5g25230.1 68418.m02991 elongation factor Tu family protein
           translation Elongation Factor 2, Schizosaccharomyces
           pombe, PIR:T39902
          Length = 973

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 21/56 (37%), Positives = 34/56 (60%)
 Frame = +3

Query: 342 EKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALXXXXXXXXXXXQTETVLRQAM 509
           +   K +L N++D+PG+V+FS E+TA+LR+ DGA+            TE  +R A+
Sbjct: 189 DSRSKSYLCNIMDTPGNVNFSDEMTASLRLADGAVFIVDAAQGVMVNTERAIRHAI 244



 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 24/79 (30%), Positives = 41/79 (51%)
 Frame = +2

Query: 527 ILFMNKMDRXXXXXXXXXXXXYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGF 706
           ++ +NK+DR            Y   +  +E +N  I+  + +   +    +DP+ G+V F
Sbjct: 251 VVVINKVDRLITELKLPPRDAYYKLRYTIEVINNHISAASTNAADLP--LIDPAAGNVCF 308

Query: 707 GSGLHGWAFTLKQFSEMYA 763
            SG  GW+FTL+ F+ MYA
Sbjct: 309 ASGTAGWSFTLQSFARMYA 327



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 3/59 (5%)
 Frame = +1

Query: 88  GMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARA---GETRFTDTRKDEQDR 255
           G+M     +RN++++ H+ HGK+   D LV +   ++   A      R+TDTR DEQ+R
Sbjct: 116 GLMSNPALVRNVALVGHLQHGKTVFMDMLVEQTHRMSTFNAENDKHMRYTDTRVDEQER 174


>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 26/63 (41%), Positives = 38/63 (60%)
 Frame = +3

Query: 258 ITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTD 437
           IT+K+   +MF+E + +D           +   G+L+NLID+PGHVDFS EV+ +L    
Sbjct: 112 ITVKAQTATMFYENKVED-----------QEASGYLLNLIDTPGHVDFSYEVSRSLSACQ 160

Query: 438 GAL 446
           GAL
Sbjct: 161 GAL 163



 Score = 44.4 bits (100), Expect = 9e-05
 Identities = 21/46 (45%), Positives = 29/46 (63%)
 Frame = +1

Query: 112 IRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQ 249
           IRN S+IAH+DHGKSTL D L+   G I     G+ ++ D  + E+
Sbjct: 66  IRNFSIIAHIDHGKSTLADRLMELTGTIKKGH-GQPQYLDKLQRER 110


>At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA)
           identical to SWISS-PROT:P17745 elongation factor Tu,
           chloroplast precursor (EF-Tu) [Arabidopsis thaliana]
          Length = 476

 Score = 45.6 bits (103), Expect = 4e-05
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = +1

Query: 64  NFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKD 243
           +FTV   RG  ++K+   N+  I HVDHGK+TLT +L      I  + A +    D   +
Sbjct: 63  SFTVRAARGKFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDEIDAAPE 122

Query: 244 EQDRASPLN 270
           E+ R   +N
Sbjct: 123 ERARGITIN 131


>At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha
           identical to SWISS-PROT:P13905 elongation factor 1-alpha
           (EF-1-alpha) [Arabidopsis thaliana]
          Length = 449

 Score = 32.3 bits (70), Expect = 0.37
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32


>At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score = 32.3 bits (70), Expect = 0.37
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32


>At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score = 32.3 bits (70), Expect = 0.37
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32


>At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score = 32.3 bits (70), Expect = 0.37
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 94  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 189
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLG 32


>At1g19390.1 68414.m02412 wall-associated kinase, putative similar
           to GB:CAB42872 from [Arabidopsis thaliana] (Plant Mol.
           Biol. 39 (6), 1189-1196 (1999))
          Length = 788

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = +3

Query: 240 GRTRPCITIKSTAISMFFELEEKDLVFITNPDQREKSEKGF-LINLIDS 383
           G+ RPC+    T +      +E  LV I N D  +  E+G  +IN+ DS
Sbjct: 709 GKKRPCMRKVFTDLEKILASQEDSLVNIENDDGADDEEEGMTMINIDDS 757


>At3g20280.2 68416.m02570 PHD finger family protein contains Pfam
           profile: PF00628 PHD-finger
          Length = 482

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = -1

Query: 493 TVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKS 395
           T S  T  PD  ST T APSVT+  +  + EK+
Sbjct: 383 TASPATVVPDQDSTITAAPSVTQEDSAFNTEKT 415


>At3g20280.1 68416.m02569 PHD finger family protein contains Pfam
           profile: PF00628 PHD-finger
          Length = 743

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 15/33 (45%), Positives = 19/33 (57%)
 Frame = -1

Query: 493 TVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKS 395
           T S  T  PD  ST T APSVT+  +  + EK+
Sbjct: 644 TASPATVVPDQDSTITAAPSVTQEDSAFNTEKT 676


>At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,
           putative similar to mitochondrial elongation factor Tu
           [Arabidopsis thaliana] gi|1149571|emb|CAA61511
          Length = 454

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDR 255
           N+  I HVDHGK+TLT ++         A+A      D   +E+ R
Sbjct: 69  NVGTIGHVDHGKTTLTAAITKVLAEEGKAKAIAFDEIDKAPEEKKR 114


>At2g27035.1 68415.m03248 plastocyanin-like domain-containing
           protein low similarity to SP:P80728 Mavicyanin
           {Cucurbita pepo}; contains Pfam profile PF02298:
           Plastocyanin-like domain
          Length = 163

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 11/36 (30%), Positives = 21/36 (58%)
 Frame = -2

Query: 714 PDPKPTEPLLGSTRTSPMGPPSSLYVAIMTLTFSTI 607
           P P P+ P   ++ T+P+ PP+++  AI+   F  +
Sbjct: 126 PQPPPSAPTNFTSTTTPLIPPNAITAAILIFAFKAL 161


>At1g17220.1 68414.m02098 translation initiation factor IF-2,
           chloroplast, putative similar to SP|P57997|IF2C_PHAVU
           Translation initiation factor IF-2, chloroplast
           precursor (PvIF2cp) {Phaseolus vulgaris}
          Length = 1026

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/34 (38%), Positives = 22/34 (64%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETR 222
           ++++ HVDHGK+TL D  + K+ + A    G T+
Sbjct: 504 ITIMGHVDHGKTTLLD-YIRKSKVAASEAGGITQ 536


>At5g17810.1 68418.m02088 homeobox-leucine zipper transcription
           factor family protein similar to to PRESSED FLOWER
           (GP:17907768) {Arabidopsis thaliana};
          Length = 268

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +2

Query: 131 SPTSITASQPSRTRWFPRPVSLLVRE 208
           SP+S T+++P R RW P+P  +L+ E
Sbjct: 9   SPSS-TSTEPVRARWSPKPEQILILE 33


>At5g10630.1 68418.m01231 elongation factor 1-alpha, putative /
           EF-1-alpha, putative contains similarity to
           SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha)
           [Aeropyrum pernix]
          Length = 667

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = +1

Query: 118 NMSVIAHVDHGKSTLTDSLVSKAGIIA 198
           N++++ HVD GKSTL+  L+   G I+
Sbjct: 241 NLAIVGHVDSGKSTLSGRLLHLLGRIS 267


>At3g03660.1 68416.m00369 homeobox-leucine zipper transcription
           factor family protein similar to to PRESSED FLOWER
           (GP:17907768) {Arabidopsis thaliana}
          Length = 199

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +2

Query: 131 SPTSITASQPSRTRWFPRPVSLLVRE 208
           S +  T+++P R+RW P+P  +L+ E
Sbjct: 20  SASGSTSAEPVRSRWSPKPEQILILE 45


>At1g75800.1 68414.m08805 pathogenesis-related thaumatin family
           protein similar to receptor serine/threonine kinase PR5K
           [Arabidopsis thaliana] GI:1235680; contains Pfam
           profile: PF00314 Thaumatin family
          Length = 330

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 13/30 (43%), Positives = 19/30 (63%)
 Frame = -2

Query: 714 PDPKPTEPLLGSTRTSPMGPPSSLYVAIMT 625
           PDPKPT P  G++ T+P G  S+ +  + T
Sbjct: 262 PDPKPTTP-TGTSSTTPAGDSSTTWSPVDT 290


>At1g18485.1 68414.m02307 pentatricopeptide (PPR) repeat-containing
           protein contains INTERPRO:IPR002885 PPR repeats
          Length = 970

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 10/25 (40%), Positives = 15/25 (60%)
 Frame = +2

Query: 698 VGFGSGLHGWAFTLKQFSEMYATNS 772
           +G G G+HGWA  L+   E+   N+
Sbjct: 308 IGLGKGVHGWAVKLRLDKELVLNNA 332


>At4g11160.1 68417.m01808 translation initiation factor IF-2,
           mitochondrial, putative similar to SP|P46198|IF2M_BOVIN
           Translation initiation factor IF-2, mitochondrial
           precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus}
          Length = 743

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = +1

Query: 121 MSVIAHVDHGKSTLTDSLVSKAGIIAGARAG 213
           ++V+ HVDHGK++L D+L + +  +A   AG
Sbjct: 222 VTVMGHVDHGKTSLLDALRNTS--VAAREAG 250


>At3g06620.1 68416.m00769 protein kinase family protein contains
           Pfam domain, PF00069: Protein kinase domain
          Length = 773

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 20/65 (30%), Positives = 29/65 (44%)
 Frame = -1

Query: 571 LELKKSTVHFVHEQNRLDALGIA*RSTVSVCTHTPDTQSTTTRAPSVTRSAAVTSEEKST 392
           LEL++S  H   E +RL       + + SV  H P  ++    APS  +S A +    S 
Sbjct: 14  LELEESQEHLKQEMSRLKVSTELRQRSHSVSPHRPARRNIGEGAPSWRKSGAASFRNASP 73

Query: 391 CPGES 377
              ES
Sbjct: 74  LRKES 78


>At1g66310.1 68414.m07530 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 442

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +3

Query: 621 LTSL*PHITMMVVPWVRCVSTLARALLVSGLVFMGGLS 734
           LTSL P + ++V+ WV+  + LA  +L+SG + +  L+
Sbjct: 161 LTSL-PCVKVIVLEWVKFANDLALEMLISGCLVLESLT 197


>At4g10070.1 68417.m01647 KH domain-containing protein DNA-directed
           RNA polymerase (EC 2.7.7.6) II largestchain - mouse,
           PIR2:A28490
          Length = 725

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = -3

Query: 683 GRHAPHPWDHHHR 645
           G HAPHP+D+H R
Sbjct: 375 GPHAPHPYDYHPR 387


>At1g66300.1 68414.m07529 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 456

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 12/46 (26%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
 Frame = +3

Query: 636 PHITMMVVPWVRCVSTLARALLVSGLVFMGGLS---PSNNSLRCMR 764
           P + ++V+ WV+  + LA  +L+SG + +  L+    +N++++ +R
Sbjct: 175 PSVKVIVLDWVKFANDLALEMLISGCLVLKSLTLCRSNNDNVKVLR 220


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,699,813
Number of Sequences: 28952
Number of extensions: 376417
Number of successful extensions: 1278
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 1187
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1273
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1746037600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -