SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20050
         (647 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ...   156   1e-38
At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ...   156   1e-38
At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ...   156   1e-38
At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ...   156   1e-38
At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,...    95   4e-20
At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E...    93   1e-19
At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide...    70   1e-12
At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,...    68   6e-12
At2g45030.1 68415.m05606 mitochondrial elongation factor, putati...    38   0.004
At1g45332.1 68414.m05195 mitochondrial elongation factor, putati...    38   0.004
At1g06220.2 68414.m00656 elongation factor Tu family protein sim...    36   0.031
At1g06220.1 68414.m00655 elongation factor Tu family protein sim...    36   0.031
At5g08650.1 68418.m01029 GTP-binding protein LepA, putative            35   0.041
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    35   0.041
At4g18330.2 68417.m02719 eukaryotic translation initiation facto...    35   0.054
At4g18330.1 68417.m02718 eukaryotic translation initiation facto...    35   0.054
At1g04170.1 68414.m00407 eukaryotic translation initiation facto...    34   0.071
At2g18720.1 68415.m02180 eukaryotic translation initiation facto...    34   0.094
At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    33   0.16 
At1g62750.1 68414.m07082 elongation factor Tu family protein sim...    33   0.16 
At4g11160.1 68417.m01808 translation initiation factor IF-2, mit...    33   0.22 
At5g13650.2 68418.m01585 elongation factor family protein contai...    30   1.5  
At5g13650.1 68418.m01584 elongation factor family protein contai...    30   1.5  
At1g76825.1 68414.m08940 eukaryotic translation initiation facto...    30   1.5  
At1g76810.1 68414.m08938 eukaryotic translation initiation facto...    30   1.5  
At1g76720.1 68414.m08929 eukaryotic translation initiation facto...    30   1.5  
At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha s...    29   2.0  
At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p...    29   2.0  
At1g49290.1 68414.m05525 expressed protein ; expression supporte...    29   2.0  
At1g21160.1 68414.m02646 eukaryotic translation initiation facto...    29   2.0  
At5g18340.1 68418.m02158 U-box domain-containing protein weak si...    29   2.7  
At5g44785.2 68418.m05490 expressed protein contains Pfam PF05329...    29   3.5  
At5g44785.1 68418.m05489 expressed protein contains Pfam PF05329...    29   3.5  
At5g51820.1 68418.m06425 phosphoglucomutase, chloroplast (PGM) (...    28   4.7  
At5g11610.2 68418.m01356 exostosin family protein contains Pfam ...    28   4.7  
At5g11610.1 68418.m01355 exostosin family protein contains Pfam ...    28   4.7  
At3g20440.1 68416.m02588 glycoside hydrolase family 13 protein s...    28   4.7  
At4g24015.1 68417.m03451 zinc finger (RING-H2 type) protein-rela...    28   6.1  
At1g17220.1 68414.m02098 translation initiation factor IF-2, chl...    28   6.1  
At1g78850.1 68414.m09191 curculin-like (mannose-binding) lectin ...    27   8.1  

>At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha
           identical to SWISS-PROT:P13905 elongation factor 1-alpha
           (EF-1-alpha) [Arabidopsis thaliana]
          Length = 449

 Score =  156 bits (378), Expect = 1e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  126 bits (303), Expect = 2e-29
 Identities = 59/66 (89%), Positives = 60/66 (90%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  156 bits (378), Expect = 1e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  126 bits (303), Expect = 2e-29
 Identities = 59/66 (89%), Positives = 60/66 (90%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  156 bits (378), Expect = 1e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  126 bits (303), Expect = 2e-29
 Identities = 59/66 (89%), Positives = 60/66 (90%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  156 bits (378), Expect = 1e-38
 Identities = 73/90 (81%), Positives = 81/90 (90%)
 Frame = +1

Query: 232 IGQTKG*AERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 411
           + + K   ERGITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + 
Sbjct: 60  LDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST 119

Query: 412 TGEFEAGISKNGQTREHALLAFTLGVKQLI 501
           TG FEAGISK+GQTREHALLAFTLGVKQ+I
Sbjct: 120 TGGFEAGISKDGQTREHALLAFTLGVKQMI 149



 Score =  126 bits (303), Expect = 2e-29
 Identities = 59/66 (89%), Positives = 60/66 (90%)
 Frame = +2

Query: 56  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 235
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVL
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 236 DKLKAE 253
           DKLKAE
Sbjct: 61  DKLKAE 66



 Score = 62.5 bits (145), Expect = 2e-10
 Identities = 26/42 (61%), Positives = 34/42 (80%)
 Frame = +2

Query: 521 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 646
           +T P YS+ R++EI KEVSSY+KK+GYNP  + FVPISG+ G
Sbjct: 157 ATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEG 198


>At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,
           putative similar to EF-1-alpha-related GTP-binding
           protein gi|1009232|gb|AAA79032
          Length = 532

 Score = 95.1 bits (226), Expect = 4e-20
 Identities = 43/82 (52%), Positives = 57/82 (69%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           +G T+++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE G  
Sbjct: 163 KGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETGYE 222

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
           + GQTREH  LA TLGV +LIV
Sbjct: 223 RGGQTREHVQLAKTLGVSKLIV 244



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 27/63 (42%), Positives = 45/63 (71%)
 Frame = +2

Query: 65  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 244
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  
Sbjct: 98  KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 157

Query: 245 KAE 253
           + E
Sbjct: 158 EEE 160


>At5g10630.1 68418.m01231 elongation factor 1-alpha, putative /
           EF-1-alpha, putative contains similarity to
           SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha)
           [Aeropyrum pernix]
          Length = 667

 Score = 93.5 bits (222), Expect = 1e-19
 Identities = 42/88 (47%), Positives = 61/88 (69%), Gaps = 1/88 (1%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           ERGIT+ +A+  F + +++V ++D+PGH+DF+ NMI G +QAD A+L++ A  G FEAG 
Sbjct: 300 ERGITMTVAVAYFNSKRHHVVLLDSPGHKDFVPNMIAGATQADAAILVIDASVGAFEAGF 359

Query: 436 SK-NGQTREHALLAFTLGVKQLIVGETK 516
               GQTREHA +    GV+Q+IV   K
Sbjct: 360 DNLKGQTREHARVLRGFGVEQVIVAINK 387



 Score = 73.3 bits (172), Expect = 1e-13
 Identities = 30/61 (49%), Positives = 44/61 (72%)
 Frame = +2

Query: 71  THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKA 250
           + +N+ ++GHVDSGKST +G L++  G I ++ + K+EKEA+  GKGSF YAW LD+   
Sbjct: 238 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISQKQMHKYEKEAKLQGKGSFAYAWALDESAE 297

Query: 251 E 253
           E
Sbjct: 298 E 298



 Score = 29.9 bits (64), Expect = 1.5
 Identities = 10/33 (30%), Positives = 23/33 (69%)
 Frame = +2

Query: 536 YSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 634
           YS+ RF+ IK+ V S+++   +  +++ ++P+S
Sbjct: 393 YSKERFDLIKQHVGSFLQSCRFKDSSLTWIPLS 425


>At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA)
           identical to SWISS-PROT:P17745 elongation factor Tu,
           chloroplast precursor (EF-Tu) [Arabidopsis thaliana]
          Length = 476

 Score = 70.1 bits (164), Expect = 1e-12
 Identities = 35/82 (42%), Positives = 50/82 (60%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 438
           RGITI+ A  ++ET   +   +D PGH D++KNMITG +Q D A+L+V+   G       
Sbjct: 126 RGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP---- 181

Query: 439 KNGQTREHALLAFTLGVKQLIV 504
              QT+EH LLA  +GV  ++V
Sbjct: 182 ---QTKEHILLAKQVGVPDMVV 200



 Score = 39.1 bits (87), Expect = 0.002
 Identities = 17/45 (37%), Positives = 25/45 (55%)
 Frame = +2

Query: 53  KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK 187
           K  ++K H+NI  IGHVD GK+T T  L      I     +K+++
Sbjct: 72  KFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDE 116


>At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,
           putative similar to mitochondrial elongation factor Tu
           [Arabidopsis thaliana] gi|1149571|emb|CAA61511
          Length = 454

 Score = 67.7 bits (158), Expect = 6e-12
 Identities = 35/82 (42%), Positives = 50/82 (60%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           +RGITI  A  ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+   G      
Sbjct: 113 KRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSGPDGPMP--- 169

Query: 436 SKNGQTREHALLAFTLGVKQLI 501
               QT+EH LLA  +GV  L+
Sbjct: 170 ----QTKEHILLARQVGVPSLV 187



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +2

Query: 62  KEKTHINIVVIGHVDSGKSTTT 127
           + K H+N+  IGHVD GK+T T
Sbjct: 63  RNKPHVNVGTIGHVDHGKTTLT 84


>At2g45030.1 68415.m05606 mitochondrial elongation factor, putative
           similar to SP|P25039 Elongation factor G 1,
           mitochondrial precursor (mEF-G-1) {Saccharomyces
           cerevisiae}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03764: Elongation factor
           G domain IV, PF00679: Elongation factor G C-terminus
          Length = 754

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 23/69 (33%), Positives = 32/69 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITI  A        Y V IID PGH DF   +       D A+L++ +  G     I
Sbjct: 116 EKGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSI 175

Query: 436 SKNGQTREH 462
           + + Q R +
Sbjct: 176 TVDRQMRRY 184



 Score = 27.9 bits (59), Expect = 6.1
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI +  H+DSGK+T T  +++  G I
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRI 92


>At1g45332.1 68414.m05195 mitochondrial elongation factor, putative
           similar to mitochondrial elongation factor GI:3917 from
           [Saccharomyces cerevisiae]
          Length = 754

 Score = 38.3 bits (85), Expect = 0.004
 Identities = 23/69 (33%), Positives = 32/69 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 435
           E+GITI  A        Y V IID PGH DF   +       D A+L++ +  G     I
Sbjct: 116 EKGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSI 175

Query: 436 SKNGQTREH 462
           + + Q R +
Sbjct: 176 TVDRQMRRY 184



 Score = 27.9 bits (59), Expect = 6.1
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGI 157
           NI +  H+DSGK+T T  +++  G I
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRI 92


>At1g06220.2 68414.m00656 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 35.5 bits (78), Expect = 0.031
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           + + + + L    +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 193 KAVPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At1g06220.1 68414.m00655 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 35.5 bits (78), Expect = 0.031
 Identities = 18/53 (33%), Positives = 25/53 (47%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           + + + + L    +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 193 KAVPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At5g08650.1 68418.m01029 GTP-binding protein LepA, putative
          Length = 681

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +1

Query: 256 ERGITIDIAL----WKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI +      + +E + + + +ID PGH DF   +    +  + A+L+V A  G
Sbjct: 131 ERGITIKLQAARMRYVYEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG 188



 Score = 28.3 bits (60), Expect = 4.7
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEK 178
           N  +I H+D GKST    L+   G +  R +++
Sbjct: 88  NFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKE 120


>At3g22980.1 68416.m02898 elongation factor Tu family protein
           similar to eukaryotic translation elongation factor 2
           GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 35.1 bits (77), Expect = 0.041
 Identities = 17/53 (32%), Positives = 28/53 (52%)
 Frame = +1

Query: 259 RGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           R IT+  +    +   Y + +ID+PGH DF   + T    +D A+++V A  G
Sbjct: 58  RAITMKSSSISLKYKDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEG 110



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCGG 154
           NI ++ HVD GK+T   HLI   GG
Sbjct: 11  NICILAHVDHGKTTLADHLIASSGG 35


>At4g18330.2 68417.m02719 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 471

 Score = 34.7 bits (76), Expect = 0.054
 Identities = 20/73 (27%), Positives = 35/73 (47%)
 Frame = +1

Query: 298 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 477
           T + +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH     
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAEHLASVD 177

Query: 478 TLGVKQLIVGETK 516
            + +K +I+ + K
Sbjct: 178 MMRLKHIIILQNK 190


>At4g18330.1 68417.m02718 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 284

 Score = 34.7 bits (76), Expect = 0.054
 Identities = 20/73 (27%), Positives = 35/73 (47%)
 Frame = +1

Query: 298 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAF 477
           T + +V+ +D PGH   +  M+ G +  D A+L++AA             QT EH     
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAEHLASVD 177

Query: 478 TLGVKQLIVGETK 516
            + +K +I+ + K
Sbjct: 178 MMRLKHIIILQNK 190


>At1g04170.1 68414.m00407 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to gb|U37354 from S. pombe. ESTs
           gb|T41979, gb|N37284 and gb|N37529 come from this gene
          Length = 465

 Score = 34.3 bits (75), Expect = 0.071
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 4/79 (5%)
 Frame = +1

Query: 292 FETSKY----YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 459
           FE SK     +V+ +D PGH   +  M+ G +  D A+L++AA             QT E
Sbjct: 112 FENSKMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANE------TCPQPQTSE 165

Query: 460 HALLAFTLGVKQLIVGETK 516
           H      + +K +I+ + K
Sbjct: 166 HLAAVEIMQLKHIIILQNK 184


>At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative 
          Length = 465

 Score = 33.9 bits (74), Expect = 0.094
 Identities = 20/69 (28%), Positives = 33/69 (47%)
 Frame = +1

Query: 310 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGV 489
           +V+ +D PGH   +  M+ G +  D A+LI+AA             QT EH      + +
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAIMDGALLIIAANE------TCPQPQTAEHLASVDMMHL 173

Query: 490 KQLIVGETK 516
           K +I+ + K
Sbjct: 174 KDIIIIQNK 182


>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 33.1 bits (72), Expect = 0.16
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +1

Query: 295 ETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           E S Y + +ID PGH DF   +    S    A+L+V A  G
Sbjct: 131 EASGYLLNLIDTPGHVDFSYEVSRSLSACQGALLVVDAAQG 171



 Score = 27.9 bits (59), Expect = 6.1
 Identities = 16/40 (40%), Positives = 19/40 (47%)
 Frame = +2

Query: 44  D*PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK 163
           D  K   EK   N  +I H+D GKST    L+   G I K
Sbjct: 57  DLTKFPSEKIR-NFSIIAHIDHGKSTLADRLMELTGTIKK 95


>At1g62750.1 68414.m07082 elongation factor Tu family protein
           similar to elongation factor G SP:P34811 [Glycine max
           (Soybean)]
          Length = 783

 Score = 33.1 bits (72), Expect = 0.16
 Identities = 19/54 (35%), Positives = 25/54 (46%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI  A       K+ + IID PGH DF   +       D A+ +  +  G
Sbjct: 144 ERGITITSAATTTFWDKHRINIIDTPGHVDFTLEVERALRVLDGAICLFDSVAG 197



 Score = 32.7 bits (71), Expect = 0.22
 Identities = 12/28 (42%), Positives = 20/28 (71%)
 Frame = +2

Query: 68  KTHINIVVIGHVDSGKSTTTGHLIYKCG 151
           K + NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 94  KDYRNIGIMAHIDAGKTTTTERILYYTG 121


>At4g11160.1 68417.m01808 translation initiation factor IF-2,
           mitochondrial, putative similar to SP|P46198|IF2M_BOVIN
           Translation initiation factor IF-2, mitochondrial
           precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus}
          Length = 743

 Score = 32.7 bits (71), Expect = 0.22
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +T +D PGH  F +    G +  D  VL+VAA  G
Sbjct: 270 ITFLDTPGHAAFSEMRARGAAVTDIVVLVVAADDG 304


>At5g13650.2 68418.m01585 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 676

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 19/54 (35%), Positives = 24/54 (44%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI             V IID PGH DF   +    +  D  +L+V +  G
Sbjct: 129 ERGITILSKNTSITYKNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEG 182


>At5g13650.1 68418.m01584 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 675

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 19/54 (35%), Positives = 24/54 (44%)
 Frame = +1

Query: 256 ERGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           ERGITI             V IID PGH DF   +    +  D  +L+V +  G
Sbjct: 128 ERGITILSKNTSITYKNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSVEG 181


>At1g76825.1 68414.m08940 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profile PF00009: Elongation
           factor Tu GTP binding domain
          Length = 630

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           +ID PGH  F      G+S  D A+L+V
Sbjct: 113 VIDTPGHESFTNLRSRGSSLCDLAILVV 140


>At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to IF2
           protein [Drosophila melanogaster] GI:7108770; contains
           Pfam profile PF03144: Elongation factor Tu domain 2
          Length = 1294

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           +ID PGH  F      G+S  D A+L+V
Sbjct: 772 VIDTPGHESFTNLRSRGSSLCDLAILVV 799


>At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1201

 Score = 29.9 bits (64), Expect = 1.5
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 319 IIDAPGHRDFIKNMITGTSQADCAVLIV 402
           +ID PGH  F      G+S  D A+L+V
Sbjct: 705 VIDTPGHESFTNLRSRGSSLCDLAILVV 732


>At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha
           subunit, chloroplast / 60 kDa chaperonin alpha subunit /
           CPN-60 alpha identical to SWISS-PROT:P21238- RuBisCO
           subunit binding-protein alpha subunit, chloroplast
           precursor (60 kDa chaperonin alpha subunit, CPN-60
           alpha) [Arabidopsis thaliana]
          Length = 586

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 15/58 (25%), Positives = 30/58 (51%)
 Frame = -3

Query: 405 SYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLASFELPESNIDCDTTLSSAFSLSN 232
           ++D+HS  +L+   D + D + ++      N+VL  F  P+  ++   T++ A  L N
Sbjct: 52  AFDQHSRAALQAGIDKLADCVGLTLGPRGRNVVLDEFGSPKV-VNDGVTIARAIELPN 108


>At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2,
           putative similar to ELONGATION FACTOR 2 GB:O14460 from
           [Schizosaccharomyces pombe]
          Length = 843

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 11/34 (32%), Positives = 20/34 (58%)
 Frame = +1

Query: 301 SKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 96  NEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129



 Score = 29.1 bits (62), Expect = 2.7
 Identities = 13/24 (54%), Positives = 15/24 (62%)
 Frame = +2

Query: 80  NIVVIGHVDSGKSTTTGHLIYKCG 151
           N+ VI HVD GKST T  L+   G
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVAAAG 44


>At1g49290.1 68414.m05525 expressed protein ; expression supported
           by MPSS
          Length = 338

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 2/58 (3%)
 Frame = +3

Query: 462 CLARFHPRCQTAHR-RRNKMVPLNHHTVSPDLRKSRRK-YPHTSRRLATTQLLSLSCP 629
           C   F   C+TAHR  R K + L       D++K R       S RL+  Q+   S P
Sbjct: 149 CTRAFSDLCETAHRINREKQLALEREKFIEDMKKLRLSLQQEKSNRLSVQQVKIASPP 206


>At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1088

 Score = 29.5 bits (63), Expect = 2.0
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +1

Query: 313 VTIIDAPGHRDFIKNMITGTSQADCAVLIV 402
           + +ID PGH  F      G++  D A+L+V
Sbjct: 558 ILVIDTPGHESFTNLRSRGSNLCDLAILVV 587


>At5g18340.1 68418.m02158 U-box domain-containing protein weak
           similarity to immediate-early fungal elicitor protein
           CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam
           profile PF04564: U-box domain
          Length = 456

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +3

Query: 507 RNKMVPLNHHTVSPDLRKSRRKYPHTSRRLATTQLLSLS 623
           +NK V   +H V P L KS ++    +RR AT  L SLS
Sbjct: 248 KNKTVLAENHQVIPLLAKSMKQGSVVTRRNATLTLASLS 286


>At5g44785.2 68418.m05490 expressed protein contains Pfam PF05329:
           Protein of unknown function (DUF731)
          Length = 442

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +2

Query: 515 NGSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 634
           N +TE   + P+  E K E+S++I  IG+    V F P S
Sbjct: 61  NVATEKESTPPKKIEYKPEISNWINLIGFVEQPVQFGPCS 100


>At5g44785.1 68418.m05489 expressed protein contains Pfam PF05329:
           Protein of unknown function (DUF731)
          Length = 440

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +2

Query: 515 NGSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 634
           N +TE   + P+  E K E+S++I  IG+    V F P S
Sbjct: 61  NVATEKESTPPKKIEYKPEISNWINLIGFVEQPVQFGPCS 100


>At5g51820.1 68418.m06425 phosphoglucomutase, chloroplast (PGM)
           (PGMP) / glucose phosphomutase identical to SP|Q9SCY0
           Phosphoglucomutase, chloroplast precursor (EC 5.4.2.2)
           (Glucose phosphomutase) (PGM) {Arabidopsis thaliana}
          Length = 623

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 20/56 (35%), Positives = 25/56 (44%), Gaps = 2/56 (3%)
 Frame = -3

Query: 564 LISSNLGSLYGGSVEPFC--FSYDELFDTEGESEQGMLTGLTVLRDTSFEFTGTGS 403
           L  S  G +YG  V  F   FSY +  D    S+QG+    T      F  +GTGS
Sbjct: 515 LSKSKAGDVYGNYVLQFADDFSYTDPVDGSVASKQGVRFVFTDGSRIIFRLSGTGS 570


>At5g11610.2 68418.m01356 exostosin family protein contains Pfam
           domain, PF03016: Exostosin family
          Length = 453

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +3

Query: 492 TAHRRRNKMVPLNHHTVSPDLRKSRRKYPHTS 587
           +  RRR+     + H + P + + R+KYPH S
Sbjct: 107 SGQRRRSNETASSLHPLQPKIPQIRKKYPHRS 138


>At5g11610.1 68418.m01355 exostosin family protein contains Pfam
           domain, PF03016: Exostosin family
          Length = 546

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +3

Query: 492 TAHRRRNKMVPLNHHTVSPDLRKSRRKYPHTS 587
           +  RRR+     + H + P + + R+KYPH S
Sbjct: 107 SGQRRRSNETASSLHPLQPKIPQIRKKYPHRS 138


>At3g20440.1 68416.m02588 glycoside hydrolase family 13 protein
           similar to 1,4-alpha-glucan branching enzyme [Solanum
           tuberosum] GI:1621012, 1,4-alpha-glucan branching enzyme
           (EC 2.4.1.18) from [Homo sapiens] SP|Q04446, {Solanum
           tuberosum} SP|P30924; contains Pfam profiles: PF00128
           Alpha amylase catalytic domain, PF02922 Isoamylase
           N-terminal domain
          Length = 777

 Score = 28.3 bits (60), Expect = 4.7
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%)
 Frame = +2

Query: 539 SEPR---FEEIKKEVSSYIKKIGYNPAAVAFVP 628
           SEP+   FEE  K+V  ++K+ GYN   +  VP
Sbjct: 257 SEPKVSTFEEFTKKVLPHVKRAGYNAIQLIGVP 289


>At4g24015.1 68417.m03451 zinc finger (RING-H2 type) protein-related
           low similarity to RING-H2 zinc finger protein ATL4
           [Arabidopsis thaliana] GI:4928399
          Length = 174

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +2

Query: 221 YAWVLDKLKAELSVVSQSILLSGSSKLASTMLPSLMLLDTEI 346
           Y + L +  + LS  S  IL   SS   S+ LPS+ LLD ++
Sbjct: 42  YLFYLKRRASSLSSPSPMILPVSSSHQTSSHLPSVCLLDVKV 83


>At1g17220.1 68414.m02098 translation initiation factor IF-2,
           chloroplast, putative similar to SP|P57997|IF2C_PHAVU
           Translation initiation factor IF-2, chloroplast
           precursor (PvIF2cp) {Phaseolus vulgaris}
          Length = 1026

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = +1

Query: 322 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 417
           +D PGH  F      G    D A+++VAA  G
Sbjct: 557 LDTPGHEAFGAMRARGARVTDIAIIVVAADDG 588


>At1g78850.1 68414.m09191 curculin-like (mannose-binding) lectin
           family protein low similarity to ser/thr protein kinase
           from Zea mays [GI:2598067]; contains Pfam lectin
           (probable mannose binding) domain PF01453
          Length = 441

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 2/68 (2%)
 Frame = +2

Query: 128 GHLIYKCGGIDKRT--IEKFEKEAQEMGKGSFKYAWVLDKLKAELSVVSQSILLSGSSKL 301
           G L+++    +K    I+  E     +   S K+ W       +  +V QS+ L+G +KL
Sbjct: 120 GRLVWQTNTANKGAVGIKILENGNMVIYDSSGKFVWQSFDSPTDTLLVGQSLKLNGRTKL 179

Query: 302 ASTMLPSL 325
            S + PS+
Sbjct: 180 VSRLSPSV 187


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,342,363
Number of Sequences: 28952
Number of extensions: 294168
Number of successful extensions: 986
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 928
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 983
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1344285648
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -