SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20049
         (646 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g48650.1 68414.m05445 helicase domain-containing protein cont...    31   0.87 
At5g03435.1 68418.m00297 C2 domain-containing protein contains P...    28   4.6  
At5g04895.1 68418.m00514 helicase domain-containing protein simi...    28   6.1  
At1g44090.1 68414.m05093 gibberellin 20-oxidase family protein s...    27   8.1  

>At1g48650.1 68414.m05445 helicase domain-containing protein
           contains similarity to DEIH-box RNA/DNA helicase
           [Arabidopsis thaliana] GI:5881579; contains Pfam
           profiles PF04408: Helicase associated domain (HA2),
           PF00271: Helicase conserved C-terminal domain, PF00035:
           Double-stranded RNA binding motif
          Length = 1197

 Score = 30.7 bits (66), Expect = 0.87
 Identities = 14/43 (32%), Positives = 23/43 (53%)
 Frame = +1

Query: 385 RRPQYNSLDHAAGL*KIPPWSCKSRIRRRRG*PGTSLPSPCCH 513
           +   Y++L++   L  +P W  K+  R+RRG  G  +P  C H
Sbjct: 664 KETSYDALNNTPCL--LPSWISKAAARQRRGRAGRVMPGECYH 704


>At5g03435.1 68418.m00297 C2 domain-containing protein contains Pfam
           profile PF00168: C2 domain
          Length = 745

 Score = 28.3 bits (60), Expect = 4.6
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = -3

Query: 170 SPLIINTIVFWKLENKGLTE 111
           SPLI+N +  WKLE+  L E
Sbjct: 608 SPLIVNDLKLWKLESPNLDE 627


>At5g04895.1 68418.m00514 helicase domain-containing protein similar
           to DEIH-box RNA/DNA helicase [Arabidopsis thaliana]
           GI:5881579;contains Pfam profiles PF04408: Helicase
           associated domain (HA2), PF00271: Helicase conserved
           C-terminal domain, PF00035: Double-stranded RNA binding
           motif
          Length = 581

 Score = 27.9 bits (59), Expect = 6.1
 Identities = 13/39 (33%), Positives = 21/39 (53%)
 Frame = +1

Query: 397 YNSLDHAAGL*KIPPWSCKSRIRRRRG*PGTSLPSPCCH 513
           Y++L++   L  +P W  ++  R+RRG  G   P  C H
Sbjct: 50  YDALNNTPCL--LPSWISQASARQRRGRAGRLFPGECYH 86


>At1g44090.1 68414.m05093 gibberellin 20-oxidase family protein
           similar to gibberellin 20-oxidase GI:4164141 from
           [Lactuca sativa]; contains Pfam domain PF03171
           2OG-Fe(II) oxygenase superfamily
          Length = 385

 Score = 27.5 bits (58), Expect = 8.1
 Identities = 14/41 (34%), Positives = 22/41 (53%)
 Frame = +1

Query: 124 LFSNFQNTIVFIINGDKNYRSCFNRLICENDRFVRETSFGS 246
           L  N  +T + + NG  NYRSC++R +   ++  R   F S
Sbjct: 284 LVVNVGDTFMALSNG--NYRSCYHRAVVNKEKVRRSLVFFS 322


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,256,764
Number of Sequences: 28952
Number of extensions: 332618
Number of successful extensions: 759
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 744
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 759
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1334473344
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -