SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20048
         (771 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g23530.1 68414.m02958 expressed protein                             34   0.090
At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contai...    31   0.64 
At4g24020.1 68417.m03452 RWP-RK domain-containing protein simila...    28   5.9  
At3g13620.1 68416.m01714 amino acid permease family protein weak...    28   7.9  
At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 d...    28   7.9  

>At1g23530.1 68414.m02958 expressed protein 
          Length = 189

 Score = 34.3 bits (75), Expect = 0.090
 Identities = 14/42 (33%), Positives = 20/42 (47%)
 Frame = +3

Query: 6   RGLRGGGSSKPPEPALQSKPNFTFSSHGIQEANGRVVLGGPN 131
           RG  GGG   PP P ++    F    +G   + G +  GGP+
Sbjct: 141 RGREGGGGGGPPPPNIKHAVRFKLPENGDHHSKGEIRRGGPS 182


>At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 465

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 14/30 (46%), Positives = 17/30 (56%)
 Frame = +2

Query: 530 NVVIEDLQKRINEENPPLDNDEIELQDRRG 619
           N +IE+   R +E  PPL  D IE  DR G
Sbjct: 7   NTIIEEAPPRFSELKPPLSEDIIEALDRSG 36


>At4g24020.1 68417.m03452 RWP-RK domain-containing protein similar
           to nodule inception protein [Lotus japonicus]
           GI:6448579; contains Pfam profile: PF02042 RWP-RK domain
          Length = 959

 Score = 28.3 bits (60), Expect = 5.9
 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 1/36 (2%)
 Frame = +3

Query: 3   ARGLRGGGSSKPPE-PALQSKPNFTFSSHGIQEANG 107
           A+ L     SKPPE P   + PN   S H   E NG
Sbjct: 679 AQPLNSPNGSKPPELPNTNNSPNHWSSDHSPNEPNG 714


>At3g13620.1 68416.m01714 amino acid permease family protein weak
           similarity to SP|Q9WTR6 Cystine/glutamate transporter
           (Amino acid transport system xc-) {Mus musculus};
           contains Pfam profile PF00324: Amino acid permease
          Length = 478

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 10/27 (37%), Positives = 18/27 (66%)
 Frame = +2

Query: 509 KRESIDYNVVIEDLQKRINEENPPLDN 589
           K +  ++N VI+DL   +N E+P +D+
Sbjct: 449 KTKIFEFNEVIDDLDNNVNGEHPKVDD 475


>At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3
           domain-containing protein similar to SP|Q9P6R9 Cell
           cycle control protein cwf22 {Schizosaccharomyces pombe};
           contains Pfam profiles PF02854: MIF4G domain, PF02847:
           MA3 domain
          Length = 900

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 17/46 (36%), Positives = 24/46 (52%)
 Frame = +1

Query: 631 METVSQIRRHLRLYGLLGKTYPSIISVKSIGNHLKVEILRYSAYKR 768
           +E  SQ R +LR YGLLG+ +  I  +    N  K  + +YS   R
Sbjct: 689 LECCSQERTYLRYYGLLGQRFCMINKIHQ-ENFEKCFVQQYSMIHR 733


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,748,051
Number of Sequences: 28952
Number of extensions: 305933
Number of successful extensions: 841
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 821
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 841
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1716774400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -