SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20047
         (659 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g53790.1 68414.m06122 F-box family protein contains Pfam PF00...    29   2.1  
At4g23530.1 68417.m03391 expressed protein                             29   2.7  
At2g39260.1 68415.m04821 MIF4G domain-containing protein similar...    28   4.8  
At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family ...    28   6.3  
At1g22710.1 68414.m02838 sucrose transporter / sucrose-proton sy...    28   6.3  
At1g53250.1 68414.m06034 expressed protein                             27   8.4  

>At1g53790.1 68414.m06122 F-box family protein contains Pfam
           PF00646: F-box domain; contains TIGRFAM TIGR01640 :
           F-box protein interaction domain
          Length = 444

 Score = 29.5 bits (63), Expect = 2.1
 Identities = 11/31 (35%), Positives = 20/31 (64%)
 Frame = +1

Query: 205 PLSRIQREIIEVTERERNLKKVTSESTGLCP 297
           P+ ++++EI E+TE+  +L  +    TGL P
Sbjct: 29  PIKKVEKEIKELTEKINDLCGIKESDTGLAP 59


>At4g23530.1 68417.m03391 expressed protein
          Length = 396

 Score = 29.1 bits (62), Expect = 2.7
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 2/38 (5%)
 Frame = -3

Query: 468 IDACNHLR*GQQALQESR--GRWALTNVKWRPLC*GSV 361
           +D CN +  G  ++++SR     A+T +K RPLC GSV
Sbjct: 122 LDLCNAVVNGIDSVRQSRRFAEIAVTALKQRPLCDGSV 159


>At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to
            hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile
            PF02854: MIF4G domain
          Length = 1186

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 1/71 (1%)
 Frame = +3

Query: 144  HSDIGLRYEFHHGRLTFERRSAVKDPERDHRSHREGKEFKEGHFRVNRL-MSESTIDVNH 320
            HSD     +     ++   +S  KD   +  +H E  +   G   V R   +E   D NH
Sbjct: 906  HSDTKPSNKSSSDVISSNGKSTAKDIRENGEAHGEESDSDSGSGSVVRDGQNEELDDGNH 965

Query: 321  QNGHMNGDADE 353
            + G  +GD D+
Sbjct: 966  ERGSESGDGDD 976


>At1g28060.1 68414.m03435 small nuclear ribonucleoprotein family
           protein / snRNP family protein contains similarity to
           U4/U6 small nuclear ribonucleoprotein hPrp3 [Homo
           sapiens] gi|2708307|gb|AAC51926
          Length = 786

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 17/61 (27%), Positives = 27/61 (44%)
 Frame = +3

Query: 195 ERRSAVKDPERDHRSHREGKEFKEGHFRVNRLMSESTIDVNHQNGHMNGDADEKISRTLN 374
           ER S     +RD  S  +    +EG  R +R +     D +H      GD +++  RT +
Sbjct: 4   ERYSRSHRDDRDRDSSPDHSPQREGGRRRDRDVDSKRRDSDHYRSSRRGDREDERDRTKD 63

Query: 375 R 377
           R
Sbjct: 64  R 64


>At1g22710.1 68414.m02838 sucrose transporter / sucrose-proton
           symporter (SUC2) nearly identical to sucrose-proton
           symporter SUC2 [Arabidopsis thaliana] GI:407092
          Length = 512

 Score = 27.9 bits (59), Expect = 6.3
 Identities = 10/31 (32%), Positives = 18/31 (58%)
 Frame = -3

Query: 645 RRTSDDRRETTGANTGVEGKIRGGAMAVFGV 553
           ++  + RR+  GA TG  G +  GA+ +F +
Sbjct: 383 KQAENHRRDHGGAKTGPPGNVTAGALTLFAI 413


>At1g53250.1 68414.m06034 expressed protein
          Length = 363

 Score = 27.5 bits (58), Expect = 8.4
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 1/66 (1%)
 Frame = +3

Query: 198 RRSAVKDPERDHRSHREGKEFKEGHFRVN-RLMSESTIDVNHQNGHMNGDADEKISRTLN 374
           RR+A K  ER+ +  REGK  K    R N  + S S +       H    +  KI+   +
Sbjct: 246 RRAAEKKKEREEKDRREGKIRKPKQERENPTIASRSKLKKRLTKIHKKKTSLGKIAIGTD 305

Query: 375 RAVSTS 392
           R VS +
Sbjct: 306 RVVSVA 311


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,721,439
Number of Sequences: 28952
Number of extensions: 278291
Number of successful extensions: 920
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 873
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 919
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1383534864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -