SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20045
         (722 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g02260.1 68414.m00165 transmembrane protein, putative similar...    30   1.8  
At2g37150.2 68415.m04558 zinc finger (C3HC4-type RING finger) fa...    29   4.1  
At2g37150.1 68415.m04557 zinc finger (C3HC4-type RING finger) fa...    29   4.1  
At4g37950.1 68417.m05365 expressed protein                             28   5.5  
At2g45350.1 68415.m05643 pentatricopeptide (PPR) repeat-containi...    28   5.5  
At1g73340.1 68414.m08489 cytochrome P450 family protein similar ...    28   7.2  
At1g19715.1 68414.m02461 jacalin lectin family protein similar t...    27   9.5  

>At1g02260.1 68414.m00165 transmembrane protein, putative similar to
           P protein (Melanocyte-specific transporter protein)
           (SP:Q04671) {Homo sapiens}; contains 8 transmembrane
           domains
          Length = 502

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 3/33 (9%)
 Frame = -1

Query: 254 GASAN-VVC--AGVAEQHGYKFTFMNFFKIGFP 165
           G++AN +VC  A  A  HGY  TF   FK G P
Sbjct: 456 GSAANLIVCEQARRAVSHGYTLTFTKHFKFGLP 488


>At2g37150.2 68415.m04558 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 546

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 20/66 (30%), Positives = 29/66 (43%)
 Frame = +3

Query: 42  SESLNPLPAVKS*YGQRSMPGKNAVAYNQVQ*GYDQVAYHDREAYFEEVHEGELVSVLLS 221
           S  L P P +    G R  PG+   +Y + Q  +D+VA H+R +  E + E        S
Sbjct: 373 SRHLRPPPHISWRSGDR--PGRRRSSYERFQPPFDEVALHERFSSEEFMVEDRQPQYYGS 430

Query: 222 HASADH 239
               DH
Sbjct: 431 RNMLDH 436


>At2g37150.1 68415.m04557 zinc finger (C3HC4-type RING finger)
           family protein contains Pfam profile: PF00097 zinc
           finger, C3HC4 type (RING finger)
          Length = 546

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 20/66 (30%), Positives = 29/66 (43%)
 Frame = +3

Query: 42  SESLNPLPAVKS*YGQRSMPGKNAVAYNQVQ*GYDQVAYHDREAYFEEVHEGELVSVLLS 221
           S  L P P +    G R  PG+   +Y + Q  +D+VA H+R +  E + E        S
Sbjct: 373 SRHLRPPPHISWRSGDR--PGRRRSSYERFQPPFDEVALHERFSSEEFMVEDRQPQYYGS 430

Query: 222 HASADH 239
               DH
Sbjct: 431 RNMLDH 436


>At4g37950.1 68417.m05365 expressed protein 
          Length = 678

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 10/23 (43%), Positives = 15/23 (65%)
 Frame = +1

Query: 265 RYLVRRARLGLYRFNVFYFLVGW 333
           RY++RR   G+Y + V   L+GW
Sbjct: 154 RYIIRRGVSGIYMYAVLERLIGW 176


>At2g45350.1 68415.m05643 pentatricopeptide (PPR) repeat-containing
           protein contains INTERPRO:IPR002885 PPR repeats
          Length = 606

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 19/52 (36%), Positives = 26/52 (50%)
 Frame = +3

Query: 6   RGGVTFADGRPGSESLNPLPAVKS*YGQRSMPGKNAVAYNQVQ*GYDQVAYH 161
           R  VT+A    G   L  +   K+ + Q  MP ++ VAYN +  GY Q  YH
Sbjct: 274 RDVVTWATMIDGYAKLGFVHHAKTLFDQ--MPHRDVVAYNSMMAGYVQNKYH 323


>At1g73340.1 68414.m08489 cytochrome P450 family protein similar to
           Cytochrome P450 90A1 (SP:Q42569) [Arabidopsis thaliana];
           contains Pfam profile: PF00067 cytochrome P450
          Length = 512

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/41 (31%), Positives = 20/41 (48%)
 Frame = -3

Query: 198 HLHELLQNRLPDHDRPLGRSLTVPDYMPLRFCLALISDRIR 76
           H  + +   L +HDR  G  LT  DY  + F   +I + +R
Sbjct: 334 HCPKAMTQLLEEHDRLAGGMLTWQDYKTMDFTQCVIDETLR 374


>At1g19715.1 68414.m02461 jacalin lectin family protein similar to
           agglutinin [Castanea crenata] GI:25528883; contains Pfam
           profile PF01419: Jacalin-like lectin domain
          Length = 595

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = -2

Query: 634 GAHSKAGWYVAKCGRNLHSIP*TP*RDHFQSSRIVL 527
           G H KAGWY+   G +   IP    +++  SS+I+L
Sbjct: 131 GFHGKAGWYLDAIGVHTQPIP----KENNPSSKILL 162


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,719,062
Number of Sequences: 28952
Number of extensions: 373753
Number of successful extensions: 794
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 794
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1575119672
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -