SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20041
         (743 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g17830.1 68417.m02659 peptidase M20/M25/M40 family protein si...    36   0.028
At1g62570.1 68414.m07059 flavin-containing monooxygenase family ...    29   4.3  
At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pf...    28   7.5  
At3g29375.1 68416.m03690 XH domain-containing protein contains P...    28   7.5  
At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf...    28   7.5  
At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf...    28   7.5  
At2g17530.1 68415.m02028 protein kinase family protein identical...    27   9.9  

>At4g17830.1 68417.m02659 peptidase M20/M25/M40 family protein
           similar to acetylornithine deacetylase
           (Acetylornithinase, AO; N-acetylornithinase, NAO)
           [Dictyostelium discoideum] SWISS-PROT:P54638
          Length = 440

 Score = 35.9 bits (79), Expect = 0.028
 Identities = 18/37 (48%), Positives = 22/37 (59%)
 Frame = +3

Query: 399 HLDVQPALKSDGWETEPFELVERNEKLYGRGSTDDKG 509
           H+DV  A   D WE +PF L    +KL GRG+TD  G
Sbjct: 101 HMDVVTA-NPDDWEFDPFSLSIDGDKLRGRGTTDCLG 136


>At1g62570.1 68414.m07059 flavin-containing monooxygenase family
           protein / FMO family protein low similarity to
           flavin-containing monooxygenase FMO3 [Rattus norvegicus]
           GI:12006730; contains Pfam profile PF00743:
           Flavin-binding monooxygenase-like
          Length = 461

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +1

Query: 67  YSVSSKQVSAKMATEKTLPEIFKYVDQNKDSYKQLLKEAVAIP 195
           + V SK V+A ++   TLP + + +D  K SY+   +EA+ IP
Sbjct: 337 FEVQSKWVAAVLSGRVTLPSVDEMMDDLKLSYE--TQEALGIP 377


>At5g42010.1 68418.m05114 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 709

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 10/17 (58%), Positives = 14/17 (82%)
 Frame = -2

Query: 607 RFLHTFENELQIDRQLS 557
           RF HT +N+LQ+DR +S
Sbjct: 471 RFYHTTDNQLQLDRDIS 487


>At3g29375.1 68416.m03690 XH domain-containing protein contains Pfam
           profile: PF03469: XH domain
          Length = 335

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 18/47 (38%), Positives = 22/47 (46%)
 Frame = -2

Query: 385 TVFFFGSLPNTPTKTGGS*TSLPSIV*KPTSLNSVVAPTSFNLSASS 245
           T   FGS P+    TG S +SLPS     T   S V  T  +L  +S
Sbjct: 67  TSLLFGSSPSIFGATGSSPSSLPSSASTTTHATSSVTTTQPSLGVAS 113


>At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 647

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = -2

Query: 607 RFLHTFENELQIDRQLSTSALIGIDGMQPTKYRPLSSVEPLP 482
           RF H FEN+LQ+D++      I + G +    + +S ++ LP
Sbjct: 429 RFYHIFENQLQMDQE------INVHGKKKVASKRISGLQYLP 464


>At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam
           PF00400: WD domain, G-beta repeat; similar to WD-repeat
           protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo
           sapiens]
          Length = 647

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = -2

Query: 607 RFLHTFENELQIDRQLSTSALIGIDGMQPTKYRPLSSVEPLP 482
           RF H FEN+LQ+D++      I + G +    + +S ++ LP
Sbjct: 429 RFYHIFENQLQMDQE------INVHGKKKVASKRISGLQYLP 464


>At2g17530.1 68415.m02028 protein kinase family protein identical to
           SRPK2 [Arabidopsis thaliana] gi|9843645|emb|CAC03676;
           contains protein kinase domain, Pfam:PF00069
          Length = 440

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 13/40 (32%), Positives = 18/40 (45%)
 Frame = +2

Query: 293 GCWLSNNRWQRRSTAASFSRRIG**SKKKYSLYLWSFGCT 412
           GCW  N   +   T    +  +   S   YS+ +WSF CT
Sbjct: 263 GCWADNKFAEEIQTRQYRAPEVILQSGYSYSVDMWSFACT 302


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,125,994
Number of Sequences: 28952
Number of extensions: 362947
Number of successful extensions: 956
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 940
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 956
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1643603136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -