SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20040
         (701 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g40300.1 68415.m04964 ferritin, putative similar to ferritin ...    52   3e-07
At3g56090.1 68416.m06234 ferritin, putative similar to ferritin ...    49   3e-06
At3g11050.1 68416.m01333 ferritin, putative similar to ferritin ...    47   1e-05
At5g01600.1 68418.m00075 ferritin 1 (FER1) identical to ferritin...    47   1e-05
At3g61010.1 68416.m06826 glycosyl hydrolase family protein 85 hy...    40   0.002
At2g32240.1 68415.m03940 expressed protein contains Pfam profile...    31   0.98 
At2g19410.1 68415.m02264 protein kinase family protein contains ...    29   2.3  
At4g25520.1 68417.m03680 transcriptional co-regulator family pro...    28   5.2  
At5g12040.2 68418.m01407 carbon-nitrogen hydrolase family protei...    28   6.9  
At5g12040.1 68418.m01408 carbon-nitrogen hydrolase family protei...    28   6.9  
At2g17600.1 68415.m02036 DC1 domain-containing protein contains ...    27   9.1  

>At2g40300.1 68415.m04964 ferritin, putative similar to ferritin
           subunit cowpea2 precursor [Vigna unguiculata]
           GI:2970654; contains Pfam profile PF00210: Ferritin-like
           domain
          Length = 259

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 27/62 (43%), Positives = 35/62 (56%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + +QI  E   S  Y AM AYF  D +   G AK F +++ EEREHA KL++Y   
Sbjct: 97  CEAAINEQINVEYNVSYVYHAMYAYFDRDNIALKGLAKFFKESSLEEREHAEKLMEYQNK 156

Query: 462 RG 467
           RG
Sbjct: 157 RG 158



 Score = 31.9 bits (69), Expect = 0.42
 Identities = 17/43 (39%), Positives = 23/43 (53%)
 Frame = +2

Query: 545 LEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           +E AL LE  V   +   + +  S  ND HL D++  EFL EQ
Sbjct: 185 MELALSLEKLVNEKLLN-LHSVASKNNDVHLADFIESEFLTEQ 226


>At3g56090.1 68416.m06234 ferritin, putative similar to ferritin
           subunit cowpea2 precursor [Vigna unguiculata]
           GI:2970654; contains Pfam profile PF00210: Ferritin-like
           domain
          Length = 259

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 26/62 (41%), Positives = 34/62 (54%)
 Frame = +3

Query: 282 CYNMMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLM 461
           C   + +QI  E   S  Y A+ AYF  D V   G AK F +++ EEREHA  L++Y   
Sbjct: 95  CEAAVNEQINVEYNVSYVYHALYAYFDRDNVALKGLAKFFKESSVEEREHAELLMEYQNK 154

Query: 462 RG 467
           RG
Sbjct: 155 RG 156


>At3g11050.1 68416.m01333 ferritin, putative similar to ferritin
           subunit cowpea2 precursor GI:2970654 (Vigna
           unguiculata); contains Pfam profile PF00210:
           Ferritin-like domain
          Length = 253

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 25/55 (45%), Positives = 30/55 (54%)
 Frame = +3

Query: 303 QIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           QI  E   S  Y A+ AYF  D V   GFAK F D++ EER HA   ++Y   RG
Sbjct: 96  QINVEYNVSYVYHALYAYFDRDNVGLKGFAKFFNDSSLEERGHAEMFMEYQNKRG 150



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = +2

Query: 542 ALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQ 673
           A+E AL LE  +TN     +++     ND  LVD++  EFL EQ
Sbjct: 176 AMELALSLEK-LTNEKLLKLQSVGVKNNDVQLVDFVESEFLGEQ 218


>At5g01600.1 68418.m00075 ferritin 1 (FER1) identical to ferritin
           [Arabidopsis thaliana] GI:1246401, GI:8163920
          Length = 255

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 24/59 (40%), Positives = 33/59 (55%)
 Frame = +3

Query: 291 MMRKQIQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDYLLMRG 467
           ++ +QI  E   S  Y +M AYF  D V   G AK F +++ EER HA K ++Y   RG
Sbjct: 97  VINEQINVEYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRG 155


>At3g61010.1 68416.m06826 glycosyl hydrolase family protein 85
           hypothetical protein F9F8.14 - Arabidopsis thaliana,
           EMBL:AC009991
          Length = 355

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 20/49 (40%), Positives = 26/49 (53%)
 Frame = +3

Query: 306 IQEEVAASIQYLAMGAYFSIDTVNRPGFAKLFFDAATEEREHATKLIDY 452
           I  E   S  Y A+ AY   D V   GF K F D++ EER +A K ++Y
Sbjct: 297 IDVEYNVSYVYHALDAYIERDNVGLKGFTKFFNDSSLEERGYAEKFMEY 345


>At2g32240.1 68415.m03940 expressed protein contains Pfam profile:
           PF04508 viral A-type inclusion protein repeat
          Length = 775

 Score = 30.7 bits (66), Expect = 0.98
 Identities = 20/65 (30%), Positives = 26/65 (40%)
 Frame = +2

Query: 383 RLREAILRCCD*RTRARDQAH*LPAHEGKADRLRNRPHHVQGPANTSWESGASALEHALK 562
           RL EAI R     T + D    L  HE + +  +   H   G A+T       AL     
Sbjct: 368 RLEEAIERFNQKETESSDLVEKLKTHENQIEEYKKLAHEASGVADTRKVELEDALSKLKN 427

Query: 563 LESDV 577
           LES +
Sbjct: 428 LESTI 432


>At2g19410.1 68415.m02264 protein kinase family protein contains
           Pfam profile: PF00069 Eukaryotic protein kinase domain
          Length = 801

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 16/62 (25%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +2

Query: 503 QGPANTSWESGASALEHAL-KLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 679
           + P  TS +S    +E  + +L++++ +++ +  + CE  F+  + V  LS E+L+E  +
Sbjct: 297 RSPPETSRKSKKVEIEEEVERLKNELQSTVFKYKQACEELFSTQNKVKMLSTEYLNESKR 356

Query: 680 GN 685
            N
Sbjct: 357 VN 358


>At4g25520.1 68417.m03680 transcriptional co-regulator family
           protein contains similarity to GP|18033922|gb|AAL57277
           SEUSS transcriptional co-regulator [Arabidopsis
           thaliana]
          Length = 748

 Score = 28.3 bits (60), Expect = 5.2
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +1

Query: 379 APASRSYSSMLRLKNASTRPSSLTTCS*GES*QAP*PTSSRT 504
           A A  +Y SML  +NA   P+S T    G S Q P P S+++
Sbjct: 558 AAALTNYQSMLMRQNAMNNPNSNTGKQEGFSSQNPTPNSNQS 599


>At5g12040.2 68418.m01407 carbon-nitrogen hydrolase family protein
           similar to Nit protein 2 [Homo sapiens] GI:9367116;
           contains Pfam profile PF00795: hydrolase,
           carbon-nitrogen family
          Length = 294

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +2

Query: 530 SGASALEHALKLESDVTNSIREVIKTCESSFN 625
           S  S   H LKL S  T+++R +  +  SSFN
Sbjct: 37  SPRSITSHTLKLPSSSTSALRSISSSMASSFN 68


>At5g12040.1 68418.m01408 carbon-nitrogen hydrolase family protein
           similar to Nit protein 2 [Homo sapiens] GI:9367116;
           contains Pfam profile PF00795: hydrolase,
           carbon-nitrogen family
          Length = 369

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 13/32 (40%), Positives = 18/32 (56%)
 Frame = +2

Query: 530 SGASALEHALKLESDVTNSIREVIKTCESSFN 625
           S  S   H LKL S  T+++R +  +  SSFN
Sbjct: 37  SPRSITSHTLKLPSSSTSALRSISSSMASSFN 68


>At2g17600.1 68415.m02036 DC1 domain-containing protein contains
           Pfam profile PF03107: DC1 domain
          Length = 580

 Score = 27.5 bits (58), Expect = 9.1
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = -2

Query: 568 LQLEGVLEG*CAALPRRVCGALYVMRSVTEPVSFPLMSR*SMSLVACSRSS 416
           +Q +  L   CA LPR++  AL+    V +P   P++   S S   C+R S
Sbjct: 321 VQCDFFLHEVCAGLPRKLAHALHKHPLVLDP--SPILDYSSTSCSTCARES 369


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,975,746
Number of Sequences: 28952
Number of extensions: 276081
Number of successful extensions: 669
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 651
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 668
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1506636208
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -