SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20031
         (764 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) simi...    60   2e-09
At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) simi...    58   8e-09
At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) simi...    55   5e-08
At1g78280.1 68414.m09122 transcription factor jumonji (jmjC) dom...    31   1.1  

>At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) similar
           to GI:6984132 from [Euphorbia esula]
          Length = 112

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 30/42 (71%), Positives = 32/42 (76%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVAAKK KK+ E INSRLALVMKSGKY LGYK  LK    +K
Sbjct: 1   MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSK 42



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 19/53 (35%), Positives = 30/53 (56%)
 Frame = +2

Query: 158 SKETEKDHRVN*LPPCLGDEIGKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           +K+T+K H        L  + GK  L  ++  ++LR  K KL++I+ N PPLR
Sbjct: 4   AKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLR 56


>At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) similar
           to 60S RIBOSOMAL PROTEIN L30 GB:O49884 from [Lupinus
           luteus]
          Length = 112

 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 29/42 (69%), Positives = 31/42 (73%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKLFDKAK 275
           MVA KK KK+ E INSRLALVMKSGKY LGYK  LK    +K
Sbjct: 1   MVAEKKAKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSK 42



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 14/32 (43%), Positives = 21/32 (65%)
 Frame = +2

Query: 221 GKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           GK  L  ++  ++LR  K KL++I+ N PPLR
Sbjct: 25  GKYTLGYKSVLKSLRSSKGKLILISSNCPPLR 56


>At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) similar
           to ribosomal protein L30 GI:388034 from [Homo sapiens]
          Length = 112

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 27/36 (75%), Positives = 28/36 (77%)
 Frame = +3

Query: 150 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLK 257
           MV  KK KK+ E INSRLALVMKSGKY LGYK  LK
Sbjct: 1   MVTEKKTKKSHEGINSRLALVMKSGKYTLGYKSVLK 36



 Score = 34.3 bits (75), Expect = 0.090
 Identities = 19/52 (36%), Positives = 29/52 (55%)
 Frame = +2

Query: 161 KETEKDHRVN*LPPCLGDEIGKILLRIQANFETLRQGKAKLVIIAKNAPPLR 316
           K+T+K H        L  + GK  L  ++  ++LR  K KL++I+ N PPLR
Sbjct: 5   KKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPLR 56


>At1g78280.1 68414.m09122 transcription factor jumonji (jmjC)
           domain-containing protein contains Pfam PF00646: F-box
           domain; contains Pfam PF02373: jmjC domain; similar to
           apoptotic cell clearance receptor PtdSerR (GI:11037740)
           [Mus musculus]
          Length = 916

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = -2

Query: 655 KHNSYLPKCSIEFKDYSIGSPHCD 584
           +HNS+ P   ++F D +IG P CD
Sbjct: 796 QHNSWRPSHILDFSDLTIGDPICD 819


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,589,676
Number of Sequences: 28952
Number of extensions: 309837
Number of successful extensions: 564
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 564
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1712086600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -