SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20030
         (713 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ...   248   3e-66
At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ...   248   3e-66
At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ...   248   3e-66
At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ...   248   3e-66
At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E...   153   8e-38
At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,...   147   6e-36
At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide...    78   7e-15
At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,...    73   2e-13
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    43   2e-04
At4g18330.2 68417.m02719 eukaryotic translation initiation facto...    38   0.005
At4g18330.1 68417.m02718 eukaryotic translation initiation facto...    38   0.005
At2g18720.1 68415.m02180 eukaryotic translation initiation facto...    37   0.015
At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p...    36   0.020
At1g04170.1 68414.m00407 eukaryotic translation initiation facto...    36   0.020
At2g45030.1 68415.m05606 mitochondrial elongation factor, putati...    35   0.047
At1g45332.1 68414.m05195 mitochondrial elongation factor, putati...    35   0.047
At5g08650.1 68418.m01029 GTP-binding protein LepA, putative            35   0.062
At1g06220.2 68414.m00656 elongation factor Tu family protein sim...    33   0.19 
At1g06220.1 68414.m00655 elongation factor Tu family protein sim...    33   0.19 
At1g62750.1 68414.m07082 elongation factor Tu family protein sim...    31   0.57 
At1g17220.1 68414.m02098 translation initiation factor IF-2, chl...    31   0.76 
At3g01360.1 68416.m00057 expressed protein contains Pfam profile...    31   1.0  
At5g13650.2 68418.m01585 elongation factor family protein contai...    30   1.3  
At5g13650.1 68418.m01584 elongation factor family protein contai...    30   1.3  
At4g20430.1 68417.m02981 subtilase family protein contains Pfam ...    30   1.8  
At4g11160.1 68417.m01808 translation initiation factor IF-2, mit...    29   2.3  
At1g30900.1 68414.m03780 vacuolar sorting receptor, putative sim...    29   2.3  
At1g76720.1 68414.m08929 eukaryotic translation initiation facto...    29   3.1  
At5g25230.1 68418.m02991 elongation factor Tu family protein tra...    29   4.0  
At1g76825.1 68414.m08940 eukaryotic translation initiation facto...    29   4.0  
At1g76810.1 68414.m08938 eukaryotic translation initiation facto...    29   4.0  
At1g47840.1 68414.m05325 hexokinase, putative similar to hexokin...    29   4.0  
At3g43240.1 68416.m04564 ARID/BRIGHT DNA-binding domain-containi...    28   5.3  
At1g21160.1 68414.m02646 eukaryotic translation initiation facto...    28   5.3  
At3g18370.1 68416.m02336 C2 domain-containing protein contains P...    28   7.1  
At1g69900.1 68414.m08044 expressed protein  contains Pfam profil...    28   7.1  

>At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha
           identical to SWISS-PROT:P13905 elongation factor 1-alpha
           (EF-1-alpha) [Arabidopsis thaliana]
          Length = 449

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/169 (72%), Positives = 135/169 (79%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLK
Sbjct: 5   KFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLK 64

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           AERER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FE
Sbjct: 65  AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFE 124

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           AGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 125 AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKE 173



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/169 (72%), Positives = 135/169 (79%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLK
Sbjct: 5   KFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLK 64

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           AERER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FE
Sbjct: 65  AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFE 124

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           AGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 125 AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKE 173



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/169 (72%), Positives = 135/169 (79%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLK
Sbjct: 5   KFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLK 64

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           AERER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FE
Sbjct: 65  AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFE 124

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           AGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 125 AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKE 173



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  248 bits (607), Expect = 3e-66
 Identities = 123/169 (72%), Positives = 135/169 (79%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           +  INIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA EM K SFKYAWVLDKLK
Sbjct: 5   KFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLK 64

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
           AERER         +    +  C  IDAPGHRDFIKNMITGTSQADCAVLI+ + TG FE
Sbjct: 65  AERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFE 124

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
           AGISK+GQTREHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KE
Sbjct: 125 AGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKE 173



 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 25/39 (64%), Positives = 32/39 (82%)
 Frame = +3

Query: 510 SSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTKMPWFKG 626
           SSY+KK+GYNP  + FVPISG+ GDNM+E ST + W+KG
Sbjct: 175 SSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKG 213


>At5g10630.1 68418.m01231 elongation factor 1-alpha, putative /
           EF-1-alpha, putative contains similarity to
           SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha)
           [Aeropyrum pernix]
          Length = 667

 Score =  153 bits (372), Expect = 8e-38
 Identities = 76/167 (45%), Positives = 107/167 (64%), Gaps = 1/167 (0%)
 Frame = +1

Query: 7   EINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAE 186
           ++N+ ++GHVDSGKST +G L++  G I ++ + K+EKEA+  GKGSF YAW LD+   E
Sbjct: 239 QLNLAIVGHVDSGKSTLSGRLLHLLGRISQKQMHKYEKEAKLQGKGSFAYAWALDESAEE 298

Query: 187 RERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           RER            + +     +D+PGH+DF+ NMI G +QAD A+L++ A  G FEAG
Sbjct: 299 RERGITMTVAVAYFNSKRHHVVLLDSPGHKDFVPNMIAGATQADAAILVIDASVGAFEAG 358

Query: 367 ISK-NGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
                GQTREHA +    GV+Q+IV +NKMD     YS+ RF+ IK+
Sbjct: 359 FDNLKGQTREHARVLRGFGVEQVIVAINKMDIV--GYSKERFDLIKQ 403


>At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,
           putative similar to EF-1-alpha-related GTP-binding
           protein gi|1009232|gb|AAA79032
          Length = 532

 Score =  147 bits (357), Expect = 6e-36
 Identities = 73/169 (43%), Positives = 108/169 (63%)
 Frame = +1

Query: 1   RHEINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLK 180
           RH +N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  + S+  A+++D  +
Sbjct: 100 RH-LNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTNE 158

Query: 181 AERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFE 360
            ER +                    +DAPGH+ ++ NMI+G SQAD  VL+++A  GEFE
Sbjct: 159 EERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFE 218

Query: 361 AGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKE 507
            G  + GQTREH  LA TLGV +LIV VNKMD     +S+ R++EI+++
Sbjct: 219 TGYERGGQTREHVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQK 267



 Score = 28.7 bits (61), Expect = 4.0
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = +3

Query: 516 YIKKIGYNPAA-VAFVPISGWHGDNMLEPSTK--MPWFKG 626
           ++K  GYN    V F+PISG  G NM +   +   PW+ G
Sbjct: 271 FLKASGYNTKKDVVFLPISGLMGKNMDQRMGQEICPWWSG 310


>At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA)
           identical to SWISS-PROT:P17745 elongation factor Tu,
           chloroplast precursor (EF-Tu) [Arabidopsis thaliana]
          Length = 476

 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 50/152 (32%), Positives = 72/152 (47%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +NI  IGHVD GK+T T  L      I     +K+++               +D    ER
Sbjct: 80  VNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYDE---------------IDAAPEER 124

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
            R       ++E         H+D PGH D++KNMITG +Q D A+L+V+   G      
Sbjct: 125 ARGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMP--- 181

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTE 465
               QT+EH LLA  +GV  ++V +NK D  +
Sbjct: 182 ----QTKEHILLAKQVGVPDMVVFLNKEDQVD 209


>At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,
           putative similar to mitochondrial elongation factor Tu
           [Arabidopsis thaliana] gi|1149571|emb|CAA61511
          Length = 454

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 50/154 (32%), Positives = 72/154 (46%)
 Frame = +1

Query: 10  INIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAER 189
           +N+  IGHVD GK+T T  +                K   E GK        +DK   E+
Sbjct: 68  VNVGTIGHVDHGKTTLTAAIT---------------KVLAEEGKAKAIAFDEIDKAPEEK 112

Query: 190 ERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           +R        +E    +    H+D PGH D++KNMITG +Q D  +L+V+   G      
Sbjct: 113 KRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSGPDGPMP--- 169

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 471
               QT+EH LLA  +GV  L+  +NK+D  + P
Sbjct: 170 ----QTKEHILLARQVGVPSLVCFLNKVDVVDDP 199


>At3g22980.1 68416.m02898 elongation factor Tu family protein
           similar to eukaryotic translation elongation factor 2
           GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 34/113 (30%), Positives = 50/113 (44%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ HVD GK+T   HLI   GG             +  GK  F     +D L  E+ 
Sbjct: 11  NICILAHVDHGKTTLADHLIASSGG--------GVLHPRLAGKLRF-----MDYLDEEQR 57

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R    +  S+ ++        ID+PGH DF   + T    +D A+++V A  G
Sbjct: 58  RAITMKSSSISLKYKDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEG 110


>At4g18330.2 68417.m02719 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 471

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 27/97 (27%), Positives = 44/97 (45%)
 Frame = +1

Query: 214 CSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 393
           C + +R   V C  +D PGH   +  M+ G +  D A+L++AA             QT E
Sbjct: 121 CKMTLRR-HVSC--VDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAE 171

Query: 394 HALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
           H      + +K +I+  NK+D      +  + E I+K
Sbjct: 172 HLASVDMMRLKHIIILQNKIDLINEKAATEQHEAIQK 208


>At4g18330.1 68417.m02718 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 284

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 27/97 (27%), Positives = 44/97 (45%)
 Frame = +1

Query: 214 CSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 393
           C + +R   V C  +D PGH   +  M+ G +  D A+L++AA             QT E
Sbjct: 121 CKMTLRR-HVSC--VDCPGHDILMATMLNGAAIVDGALLLIAANES------CPQPQTAE 171

Query: 394 HALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKK 504
           H      + +K +I+  NK+D      +  + E I+K
Sbjct: 172 HLASVDMMRLKHIIILQNKIDLINEKAATEQHEAIQK 208


>At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative 
          Length = 465

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 23/83 (27%), Positives = 40/83 (48%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+LI+AA             QT EH      + +K +I
Sbjct: 124 VDCPGHDILMATMLNGAAIMDGALLIIAANE------TCPQPQTAEHLASVDMMHLKDII 177

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   +  + E+I++
Sbjct: 178 IIQNKIDLIQENEAIKQHEDIQR 200


>At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2,
           putative similar to ELONGATION FACTOR 2 GB:O14460 from
           [Schizosaccharomyces pombe]
          Length = 843

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 5/117 (4%)
 Frame = +1

Query: 1   RHEI-NIVVIGHVDSGKSTTTGHLIYKCGGIDKRT---IEKFEKEAQEMGKG-SFKYAWV 165
           +H I N+ VI HVD GKST T  L+   G I +     +   +  A E  +G + K   +
Sbjct: 16  KHNIRNMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGI 75

Query: 166 LDKLKAERERRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIV 336
              L  E        +      N + L   ID+PGH DF   +       D A+++V
Sbjct: 76  --SLYYEMTDESLKSFTGARDGN-EYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>At1g04170.1 68414.m00407 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to gb|U37354 from S. pombe. ESTs
           gb|T41979, gb|N37284 and gb|N37529 come from this gene
          Length = 465

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 23/83 (27%), Positives = 39/83 (46%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           +D PGH   +  M+ G +  D A+L++AA             QT EH      + +K +I
Sbjct: 126 VDCPGHDILMATMLNGAAIMDGALLLIAANE------TCPQPQTSEHLAAVEIMQLKHII 179

Query: 436 VGVNKMDSTEPPYSEPRFEEIKK 504
           +  NK+D  +   +  + E I+K
Sbjct: 180 ILQNKIDLIQENVAINQHEAIQK 202


>At2g45030.1 68415.m05606 mitochondrial elongation factor, putative
           similar to SP|P25039 Elongation factor G 1,
           mitochondrial precursor (mEF-G-1) {Saccharomyces
           cerevisiae}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03764: Elongation factor
           G domain IV, PF00679: Elongation factor G C-terminus
          Length = 754

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 33/128 (25%), Positives = 55/128 (42%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  +++  G    R  E  E   ++ G G+      +D +  ERE
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTG----RIHEIHEVRGRD-GVGA-----KMDSMDLERE 116

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           +    +  +            ID PGH DF   +       D A+L++ +  G     I+
Sbjct: 117 KGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSIT 176

Query: 373 KNGQTREH 396
            + Q R +
Sbjct: 177 VDRQMRRY 184


>At1g45332.1 68414.m05195 mitochondrial elongation factor, putative
           similar to mitochondrial elongation factor GI:3917 from
           [Saccharomyces cerevisiae]
          Length = 754

 Score = 35.1 bits (77), Expect = 0.047
 Identities = 33/128 (25%), Positives = 55/128 (42%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI +  H+DSGK+T T  +++  G    R  E  E   ++ G G+      +D +  ERE
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTG----RIHEIHEVRGRD-GVGA-----KMDSMDLERE 116

Query: 193 RRYHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 372
           +    +  +            ID PGH DF   +       D A+L++ +  G     I+
Sbjct: 117 KGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSIT 176

Query: 373 KNGQTREH 396
            + Q R +
Sbjct: 177 VDRQMRRY 184


>At5g08650.1 68418.m01029 GTP-binding protein LepA, putative
          Length = 681

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 44/165 (26%), Positives = 71/165 (43%), Gaps = 3/165 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           N  +I H+D GKST    L+   G +  R +++   +  ++     +   +  KL+A R 
Sbjct: 88  NFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKEQFLDNMDLE----RERGITIKLQAARM 143

Query: 193 RR-YHNRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGI 369
           R  Y +    L +         ID PGH DF   +    +  + A+L+V A  G  EA  
Sbjct: 144 RYVYEDTPFCLNL---------IDTPGHVDFSYEVSRSLAACEGALLVVDASQG-VEA-- 191

Query: 370 SKNGQTREHALLAFTLGVKQLIVGVNKMD--STEPPYSEPRFEEI 498
               QT  +  LA    + ++I  +NK+D    EP       EE+
Sbjct: 192 ----QTLANVYLALENNL-EIIPVLNKIDLPGAEPEKVLREIEEV 231


>At1g06220.2 68414.m00656 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = +1

Query: 229 RN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R+   LC  +D PGH +F   M      AD AVLIV A  G
Sbjct: 205 RSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At1g06220.1 68414.m00655 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 18/41 (43%), Positives = 21/41 (51%)
 Frame = +1

Query: 229 RN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R+   LC  +D PGH +F   M      AD AVLIV A  G
Sbjct: 205 RSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At1g62750.1 68414.m07082 elongation factor Tu family protein
           similar to elongation factor G SP:P34811 [Glycine max
           (Soybean)]
          Length = 783

 Score = 31.5 bits (68), Expect = 0.57
 Identities = 11/24 (45%), Positives = 18/24 (75%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCG 84
           NI ++ H+D+GK+TTT  ++Y  G
Sbjct: 98  NIGIMAHIDAGKTTTTERILYYTG 121


>At1g17220.1 68414.m02098 translation initiation factor IF-2,
           chloroplast, putative similar to SP|P57997|IF2C_PHAVU
           Translation initiation factor IF-2, chloroplast
           precursor (PvIF2cp) {Phaseolus vulgaris}
          Length = 1026

 Score = 31.1 bits (67), Expect = 0.76
 Identities = 20/70 (28%), Positives = 30/70 (42%)
 Frame = +1

Query: 247 CYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 426
           C  +D PGH  F      G    D A+++VAA  G          QT E A+        
Sbjct: 554 CVFLDTPGHEAFGAMRARGARVTDIAIIVVAADDG-------IRPQTNE-AIAHAKAAAV 605

Query: 427 QLIVGVNKMD 456
            +++ +NK+D
Sbjct: 606 PIVIAINKID 615


>At3g01360.1 68416.m00057 expressed protein contains Pfam profile
           PF04819: Family of unknown function (DUF716) (Plant
           viral-response family)
          Length = 319

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 21/73 (28%), Positives = 32/73 (43%), Gaps = 1/73 (1%)
 Frame = +1

Query: 250 YHIDAPGHRDFIKNMITGTSQADCAV-LIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 426
           + I   GH D+ +     T Q +C + L+V   TG F    +KNG  R+       LG +
Sbjct: 224 FTIKCKGHGDYHRAKAIATLQFNCHLALMVVVATGLFSVIANKNGYLRQDHSKYRPLGAE 283

Query: 427 QLIVGVNKMDSTE 465
              +    +DS E
Sbjct: 284 LENLSTFTLDSDE 296


>At5g13650.2 68418.m01585 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 676

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 43/161 (26%), Positives = 68/161 (42%), Gaps = 2/161 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ HVD GK+T    ++ +          K  ++ Q M +       ++D    ERE
Sbjct: 85  NIAIVAHVDHGKTTLVDSMLRQA---------KVFRDNQVMQER------IMDSNDLERE 129

Query: 193 RRYH--NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           R     ++  S+  +N +V    ID PGH DF   +    +  D  +L+V +  G     
Sbjct: 130 RGITILSKNTSITYKNTKVNI--IDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMP-- 185

Query: 367 ISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRF 489
                QTR     A   G   ++V VNK+D    P + P F
Sbjct: 186 -----QTRFVLKKALEFG-HAVVVVVNKIDR---PSARPEF 217


>At5g13650.1 68418.m01584 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 675

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 43/161 (26%), Positives = 68/161 (42%), Gaps = 2/161 (1%)
 Frame = +1

Query: 13  NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERE 192
           NI ++ HVD GK+T    ++ +          K  ++ Q M +       ++D    ERE
Sbjct: 84  NIAIVAHVDHGKTTLVDSMLRQA---------KVFRDNQVMQER------IMDSNDLERE 128

Query: 193 RRYH--NRYCSLEVRN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAG 366
           R     ++  S+  +N +V    ID PGH DF   +    +  D  +L+V +  G     
Sbjct: 129 RGITILSKNTSITYKNTKVNI--IDTPGHSDFGGEVERVLNMVDGVLLVVDSVEGPMP-- 184

Query: 367 ISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRF 489
                QTR     A   G   ++V VNK+D    P + P F
Sbjct: 185 -----QTRFVLKKALEFG-HAVVVVVNKIDR---PSARPEF 216


>At4g20430.1 68417.m02981 subtilase family protein contains Pfam
           profile: PF00082 subtilase family
          Length = 856

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 23/68 (33%), Positives = 32/68 (47%)
 Frame = -3

Query: 429 LFDTEGESEQGMLTGLTVLRDTSFEFTGTGSYDEHSAISLRGSCDHVLDEISVSRSINVV 250
           +FDT  E     L G+       F +TGT     ++ IS  GS D  L  I+VS+  N  
Sbjct: 714 IFDTSFEDYMSFLCGINGSAPVVFNYTGTNCLRNNATIS--GS-DLNLPSITVSKLNNTR 770

Query: 249 T*YLLVSN 226
           T   L++N
Sbjct: 771 TVQRLMTN 778


>At4g11160.1 68417.m01808 translation initiation factor IF-2,
           mitochondrial, putative similar to SP|P46198|IF2M_BOVIN
           Translation initiation factor IF-2, mitochondrial
           precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus}
          Length = 743

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           +D PGH  F +    G +  D  VL+VAA  G
Sbjct: 273 LDTPGHAAFSEMRARGAAVTDIVVLVVAADDG 304


>At1g30900.1 68414.m03780 vacuolar sorting receptor, putative
           similar to BP-80 vacuolar sorting receptor [Pisum
           sativum] GI:1737222
          Length = 631

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 7/57 (12%)
 Frame = +1

Query: 559 CPFLDGTE------TTCWSLQP-KCLGSRDGRWSVRKAKLTENASLKLSMPSCHLPP 708
           CP ++G +      T+C    P +C  ++ G WS  K  LT +A   L    C  PP
Sbjct: 446 CPVVNGVQYKGDGYTSCEPYGPARCSINQGGCWSETKKGLTFSACSNLETSGCRCPP 502


>At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1201

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 21/67 (31%), Positives = 33/67 (49%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F      G+S  D A+L+V     + + G+    QT E +L    +   + I
Sbjct: 706 IDTPGHESFTNLRSRGSSLCDLAILVV-----DIKHGLEP--QTIE-SLNLLRMRNTEFI 757

Query: 436 VGVNKMD 456
           + +NK+D
Sbjct: 758 IALNKVD 764


>At5g25230.1 68418.m02991 elongation factor Tu family protein
           translation Elongation Factor 2, Schizosaccharomyces
           pombe, PIR:T39902
          Length = 973

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +1

Query: 229 RN*QVLCYHIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 351
           R+   LC  +D PG+ +F   M      AD AV IV A  G
Sbjct: 191 RSKSYLCNIMDTPGNVNFSDEMTASLRLADGAVFIVDAAQG 231


>At1g76825.1 68414.m08940 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profile PF00009: Elongation
           factor Tu GTP binding domain
          Length = 630

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIV 336
           ID PGH  F      G+S  D A+L+V
Sbjct: 114 IDTPGHESFTNLRSRGSSLCDLAILVV 140


>At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to IF2
           protein [Drosophila melanogaster] GI:7108770; contains
           Pfam profile PF03144: Elongation factor Tu domain 2
          Length = 1294

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 12/27 (44%), Positives = 15/27 (55%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIV 336
           ID PGH  F      G+S  D A+L+V
Sbjct: 773 IDTPGHESFTNLRSRGSSLCDLAILVV 799


>At1g47840.1 68414.m05325 hexokinase, putative similar to hexokinase
           1 [Arabidopsis thaliana] Swiss-Prot:Q42525
          Length = 493

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +3

Query: 591 LEPSTKMPWFKGWQVERKEGKADGKCLIEALDA 689
           ++  T   W KG++V   EGK    CL EA++A
Sbjct: 189 IDSGTLSKWTKGFKVSGMEGKNVVACLNEAMEA 221


>At3g43240.1 68416.m04564 ARID/BRIGHT DNA-binding domain-containing
           protein contains Pfam profile PF01388: ARID/BRIGHT DNA
           binding domain
          Length = 747

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 13/34 (38%), Positives = 16/34 (47%)
 Frame = +2

Query: 527 DWLQPSCCRFRAHFWMARRQHVGAFNQNALVQGM 628
           DW+    C   AHF   RR  +GAF   A   G+
Sbjct: 687 DWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGL 720


>At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1088

 Score = 28.3 bits (60), Expect = 5.3
 Identities = 22/67 (32%), Positives = 31/67 (46%)
 Frame = +1

Query: 256 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLI 435
           ID PGH  F      G++  D A+L+V     +   G+    QT E   L     VK  I
Sbjct: 561 IDTPGHESFTNLRSRGSNLCDLAILVV-----DIMRGLEP--QTIESLNLLRRRNVK-FI 612

Query: 436 VGVNKMD 456
           + +NK+D
Sbjct: 613 IALNKVD 619


>At3g18370.1 68416.m02336 C2 domain-containing protein contains Pfam
           profile: PF00168 C2 domain
          Length = 815

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 23/61 (37%), Positives = 26/61 (42%), Gaps = 4/61 (6%)
 Frame = +1

Query: 520 SRRLATTQLLSLS---CPFLDGTETTCWSLQPKCLGSR-DGRWSVRKAKLTENASLKLSM 687
           SR +   QLL  S   CP L G   TCWS   +    R D  W      +   A  KLSM
Sbjct: 134 SRLIENIQLLEFSLGSCPPLLGLHGTCWSKSGEQKIMRLDFNWDTTDLSILLQA--KLSM 191

Query: 688 P 690
           P
Sbjct: 192 P 192


>At1g69900.1 68414.m08044 expressed protein  contains Pfam profile:
           PF04601 protein of unknown function (DUF569
          Length = 397

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)
 Frame = -1

Query: 512 GSSFLISSNLGSLYGGSVESILFTPTMS-CLTPRVKASKACSR 387
           GSS  I S+ GSL   S   ++FTP+ S  L+P+    + CS+
Sbjct: 190 GSSESIGSDPGSLVSVSSSKLMFTPSRSGTLSPK-PTERKCSK 231


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,631,354
Number of Sequences: 28952
Number of extensions: 362851
Number of successful extensions: 1089
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 1031
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1073
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1545769616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -