SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20029
         (715 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g13920.1 68416.m01758 eukaryotic translation initiation facto...   135   2e-32
At1g72730.1 68414.m08410 eukaryotic translation initiation facto...   134   5e-32
At1g54270.1 68414.m06187 eukaryotic translation initiation facto...   134   5e-32
At3g19760.1 68416.m02501 eukaryotic translation initiation facto...   133   1e-31
At1g51380.1 68414.m05780 eukaryotic translation initiation facto...   116   2e-26
At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical ...    55   4e-08
At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical ...    55   4e-08
At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical ...    55   4e-08
At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar...    53   2e-07
At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar...    51   7e-07
At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative simila...    51   9e-07
At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative simila...    51   9e-07
At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)...    50   1e-06
At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)...    50   1e-06
At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ...    50   1e-06
At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ...    50   1e-06
At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative              50   2e-06
At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar...    48   5e-06
At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative simila...    47   1e-05
At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar...    46   2e-05
At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar...    46   2e-05
At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative              45   4e-05
At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)...    45   4e-05
At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)...    45   4e-05
At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20) ...    45   6e-05
At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /...    44   8e-05
At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative simila...    43   2e-04
At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helica...    43   2e-04
At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helica...    43   2e-04
At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative           42   3e-04
At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar...    42   3e-04
At4g37020.1 68417.m05244 expressed protein                             42   5e-04
At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA he...    41   0.001
At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA...    40   0.001
At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly iden...    40   0.002
At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative simila...    40   0.002
At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s...    39   0.003
At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative simila...    39   0.003
At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar...    39   0.004
At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative non-co...    37   0.015
At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative simila...    36   0.035
At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)...    35   0.062
At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein c...    35   0.062
At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein c...    35   0.062
At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)...    34   0.081
At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly id...    33   0.14 
At1g60930.1 68414.m06858 DNA helicase, putative strong similarit...    32   0.33 
At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)...    32   0.43 
At1g31360.1 68414.m03838 DNA helicase, putative (RECQl2) nearly ...    32   0.43 
At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical ...    31   0.76 
At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim...    31   0.76 
At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)...    31   0.76 
At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative simila...    31   1.0  
At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli...    30   1.3  
At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)...    30   1.3  
At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative simila...    30   1.3  
At5g01710.1 68418.m00088 expressed protein                             30   1.8  
At4g15850.1 68417.m02410 DEAD/DEAH box helicase, putative simila...    29   2.3  
At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contai...    29   2.3  
At5g15390.1 68418.m01800 tRNA/rRNA methyltransferase (SpoU) fami...    29   4.0  
At2g01440.1 68415.m00067 ATP-dependent DNA helicase, putative          29   4.0  
At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong ...    28   7.1  
At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative EUKARY...    28   7.1  
At5g19210.1 68418.m02288 DEAD/DEAH box helicase, putative EUKARY...    28   7.1  
At4g01760.1 68417.m00229 DC1 domain-containing protein similar t...    28   7.1  
At5g42120.1 68418.m05128 lectin protein kinase family protein co...    27   9.3  

>At3g13920.1 68416.m01758 eukaryotic translation initiation factor
           4A-1 / eIF-4A-1 eIF-4A-1 gi:15293046, gi:15450485;
           contains Pfam profile PF00270: DEAD/DEAH box helicase;
           contains Pfam profile PF00271: Helicase conserved
           C-terminal domain
          Length = 412

 Score =  135 bits (327), Expect = 2e-32
 Identities = 60/82 (73%), Positives = 71/82 (86%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ +E EEWKLETLCDLY+TL+I Q+VIF NTRRKVDWLT+ M  RD TVSA HGDMD
Sbjct: 254 QFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMD 313

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q  R++IMR+FR+GSSRVLITT
Sbjct: 314 QNTRDIIMREFRSGSSRVLITT 335



 Score = 74.9 bits (176), Expect = 5e-14
 Identities = 38/76 (50%), Positives = 47/76 (61%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VIN+DLP+  ENY                 NFVT  D R L DI+ F
Sbjct: 337 LLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKF 396

Query: 436 YHTSIVEMPSDVANLI 483
           Y+  + E+PS+VA+L+
Sbjct: 397 YNVVVEELPSNVADLL 412


>At1g72730.1 68414.m08410 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative similar to Eukaryotic
           initiation factor 4A-10 GB:P41382 [Nicotiana tabacum];
           identical to (putative) RNA helicase GB:CAA09211
           [Arabidopsis thaliana] (Nucleic Acids Res. 27 (2),
           628-636 (1999))
          Length = 414

 Score =  134 bits (324), Expect = 5e-32
 Identities = 59/82 (71%), Positives = 71/82 (86%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ ++ EEWKLETLCDLY+TL+I Q+VIF NTRRKVDWLT+ M  RD TVSA HGDMD
Sbjct: 256 QFYVNVDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMD 315

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q  R++IMR+FR+GSSRVLITT
Sbjct: 316 QNTRDIIMREFRSGSSRVLITT 337



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 36/76 (47%), Positives = 47/76 (61%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VIN+DLP+  ENY                 NF+T  D R + DI+ F
Sbjct: 339 LLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFMTSEDERMMADIQRF 398

Query: 436 YHTSIVEMPSDVANLI 483
           Y+  + E+PS+VA+L+
Sbjct: 399 YNVVVEELPSNVADLL 414


>At1g54270.1 68414.m06187 eukaryotic translation initiation factor
           4A-2 / eIF-4A-2 similar to eukaryotic translation
           initiation factor 4A GI:19696 from [Nicotiana
           plumbaginifolia]
          Length = 412

 Score =  134 bits (324), Expect = 5e-32
 Identities = 59/82 (71%), Positives = 71/82 (86%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +FY+ +E E+WKLETLCDLY+TL+I Q+VIF NTRRKVDWLT+ M  RD TVSA HGDMD
Sbjct: 254 QFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMD 313

Query: 188 QREREVIMRQFRTGSSRVLITT 253
           Q  R++IMR+FR+GSSRVLITT
Sbjct: 314 QNTRDIIMREFRSGSSRVLITT 335



 Score = 74.1 bits (174), Expect = 8e-14
 Identities = 38/76 (50%), Positives = 48/76 (63%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LLARGIDVQQVS VIN+DLP+  ENY                 NFVT  D+R L DI+ F
Sbjct: 337 LLARGIDVQQVSLVINFDLPTQPENYLHRIGRSGRFGRKGVAINFVTLDDQRMLFDIQKF 396

Query: 436 YHTSIVEMPSDVANLI 483
           Y+  + E+PS+VA+L+
Sbjct: 397 YNVVVEELPSNVADLL 412


>At3g19760.1 68416.m02501 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative / DEAD box RNA helicase,
           putative contains DEAD/DEAH helicase domain; similar to
           RNA helicase GB:CAA09195 from [Arabidopsis thaliana];
           identical to cDNA DEAD box RNA helicase, RH2 GI:3775984
          Length = 408

 Score =  133 bits (322), Expect = 1e-31
 Identities = 57/85 (67%), Positives = 72/85 (84%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           +F++A+E EEWK +TLCDLYDTL+I QAVIFCNT+RKVD+L+E M   +FTVS+MHGDM 
Sbjct: 250 QFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNTKRKVDYLSEKMRSHNFTVSSMHGDMP 309

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ER+ IM +FR+G SRVLITT  W
Sbjct: 310 QKERDAIMNEFRSGDSRVLITTDVW 334



 Score = 74.5 bits (175), Expect = 6e-14
 Identities = 39/74 (52%), Positives = 45/74 (60%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDVQQVS VINYDLP+NRE Y                 NFV   D + L+DIE +Y 
Sbjct: 335 ARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINFVKSDDIKILRDIEQYYS 394

Query: 442 TSIVEMPSDVANLI 483
           T I EMP +VA+LI
Sbjct: 395 TQIDEMPMNVADLI 408


>At1g51380.1 68414.m05780 eukaryotic translation initiation factor
           4A, putative / eIF-4A, putative
          Length = 392

 Score =  116 bits (278), Expect = 2e-26
 Identities = 50/85 (58%), Positives = 65/85 (76%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           ++Y+ ++ EEWK +TLCDLY  L+I QA+IFCNTR+KVDWLTE M   +F VS+MHGD  
Sbjct: 237 QYYVDVDKEEWKFDTLCDLYGRLTINQAIIFCNTRQKVDWLTEKMRSSNFIVSSMHGDKR 296

Query: 188 QREREVIMRQFRTGSSRVLITTVYW 262
           Q+ER+ IM QFR+  SRVLI +  W
Sbjct: 297 QKERDDIMNQFRSFKSRVLIASDVW 321



 Score = 64.1 bits (149), Expect = 9e-11
 Identities = 34/70 (48%), Positives = 40/70 (57%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARGIDVQ VS VINYD+P+N E Y                 NFV  +D + LKDIE  Y 
Sbjct: 322 ARGIDVQTVSHVINYDIPNNPELYIHRIGRAGRFGREGVAINFVKSSDMKDLKDIERHYG 381

Query: 442 TSIVEMPSDV 471
           T I EMP+D+
Sbjct: 382 TKIREMPADL 391


>At3g01540.3 68416.m00084 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 24/57 (42%), Positives = 39/57 (68%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D LT ++  R F  +A+HGD  Q ER+ ++ QFR+G + VL+ T
Sbjct: 404 SKVIIFCSTKRMCDQLTRNL-TRQFGAAAIHGDKSQPERDNVLNQFRSGRTPVLVAT 459



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ +  V+NYD P+  E+Y
Sbjct: 463 ARGLDVKDIRAVVNYDFPNGVEDY 486


>At3g01540.2 68416.m00083 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 619

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 24/57 (42%), Positives = 39/57 (68%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D LT ++  R F  +A+HGD  Q ER+ ++ QFR+G + VL+ T
Sbjct: 404 SKVIIFCSTKRMCDQLTRNL-TRQFGAAAIHGDKSQPERDNVLNQFRSGRTPVLVAT 459



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ +  V+NYD P+  E+Y
Sbjct: 463 ARGLDVKDIRAVVNYDFPNGVEDY 486


>At3g01540.1 68416.m00082 DEAD box RNA helicase (DRH1) identical to
           RNA helicase DRH1 GB:BAA28347 GI:3149952 [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 618

 Score = 55.2 bits (127), Expect = 4e-08
 Identities = 24/57 (42%), Positives = 39/57 (68%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D LT ++  R F  +A+HGD  Q ER+ ++ QFR+G + VL+ T
Sbjct: 404 SKVIIFCSTKRMCDQLTRNL-TRQFGAAAIHGDKSQPERDNVLNQFRSGRTPVLVAT 459



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 12/24 (50%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ +  V+NYD P+  E+Y
Sbjct: 463 ARGLDVKDIRAVVNYDFPNGVEDY 486


>At5g14610.1 68418.m01713 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 713

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 23/57 (40%), Positives = 38/57 (66%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D L  ++  R F  +A+HGD  Q ER+ ++ QFR+G + VL+ T
Sbjct: 475 SKIIIFCSTKRMCDQLARNL-TRTFGAAAIHGDKSQAERDDVLNQFRSGRTPVLVAT 530



 Score = 33.9 bits (74), Expect = 0.11
 Identities = 17/73 (23%), Positives = 30/73 (41%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+ +  V+NYD P+  E+Y                  F  + D +   D+     
Sbjct: 534 ARGLDVKDIRVVVNYDFPNGVEDYVHRIGRTGRAGATGLAYTFFGDQDAKHASDLIKILE 593

Query: 442 TSIVEMPSDVANL 480
            +  ++P  V  +
Sbjct: 594 GANQKVPPQVREM 606


>At3g06480.1 68416.m00750 DEAD box RNA helicase, putative similar to
           RNA helicase DRH1 [Arabidopsis thaliana] GI:3149952;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain, PF00397:
           WW domain
          Length = 1088

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 25/57 (43%), Positives = 36/57 (63%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IFC+T+R  D L  S+  R F    +HGD  Q ER+ ++ QFR+G S VLI T
Sbjct: 681 SKVIIFCSTKRLCDHLARSVG-RHFGAVVIHGDKTQGERDWVLNQFRSGKSCVLIAT 736



 Score = 37.1 bits (82), Expect = 0.012
 Identities = 19/73 (26%), Positives = 32/73 (43%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+D++ +  VINYD P+  E+Y                  F TE D +   D+     
Sbjct: 740 ARGLDIKDIRVVINYDFPTGVEDYVHRIGRTGRAGATGVAFTFFTEQDWKYAPDLIKVLE 799

Query: 442 TSIVEMPSDVANL 480
            +  ++P  V ++
Sbjct: 800 GANQQVPPQVRDI 812


>At4g00660.2 68417.m00091 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 27/83 (32%), Positives = 44/83 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T+FY  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 344 TQFYAFVE-ERQKIHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 402

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +   FR G+ R L+ T
Sbjct: 403 LQDHRNRVFHDFRNGACRNLVCT 425



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/76 (34%), Positives = 33/76 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P N E Y                 N +T  DR  L  IE  
Sbjct: 427 LFTRGIDIQAVNVVINFDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQE 486

Query: 436 YHTSIVEMPSDVANLI 483
             T I ++P  +   I
Sbjct: 487 LGTEIKQIPPHIDQAI 502


>At4g00660.1 68417.m00090 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicases
          Length = 505

 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 27/83 (32%), Positives = 44/83 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T+FY  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 344 TQFYAFVE-ERQKIHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 402

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +   FR G+ R L+ T
Sbjct: 403 LQDHRNRVFHDFRNGACRNLVCT 425



 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 26/76 (34%), Positives = 33/76 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P N E Y                 N +T  DR  L  IE  
Sbjct: 427 LFTRGIDIQAVNVVINFDFPKNAETYLHRVGRSGRFGHLGLAVNLITYEDRFNLYRIEQE 486

Query: 436 YHTSIVEMPSDVANLI 483
             T I ++P  +   I
Sbjct: 487 LGTEIKQIPPHIDQAI 502


>At3g61240.2 68416.m06854 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 45/83 (54%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 337 TQYYAFVE-ERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 395

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +  +FR G+ R L+ T
Sbjct: 396 VQDHRNRVFHEFRNGACRNLVCT 418



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 25/76 (32%), Positives = 33/76 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P   E+Y                 N VT  DR  +   E  
Sbjct: 420 LFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQE 479

Query: 436 YHTSIVEMPSDVANLI 483
             T I  +PS++   I
Sbjct: 480 LGTEIKPIPSNIDQAI 495


>At3g61240.1 68416.m06853 DEAD/DEAH box helicase, putative (RH12)
           identical to cDNA DEAD box RNA helicase, RH12 GI:3776000
          Length = 498

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 45/83 (54%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 337 TQYYAFVE-ERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 395

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +  +FR G+ R L+ T
Sbjct: 396 VQDHRNRVFHEFRNGACRNLVCT 418



 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 25/76 (32%), Positives = 33/76 (43%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P   E+Y                 N VT  DR  +   E  
Sbjct: 420 LFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQE 479

Query: 436 YHTSIVEMPSDVANLI 483
             T I  +PS++   I
Sbjct: 480 LGTEIKPIPSNIDQAI 495


>At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/54 (37%), Positives = 35/54 (64%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D L   + + +F  +++HGD  Q+EREV +R F+TG + +L+ T
Sbjct: 412 LVFVETKRGADTLENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVAT 465



 Score = 31.9 bits (69), Expect = 0.43
 Identities = 11/24 (45%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V+ V+N+DLP++ ++Y
Sbjct: 469 ARGLDIPHVAHVVNFDLPNDIDDY 492


>At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11)
           similar to RNA helicase DBY protein [Mus musculus]
           GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like
           protein 2) {Homo sapiens}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain; identical to cDNA DEAD box
           RNA helicase, RH11 GI:3775998
          Length = 612

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 20/54 (37%), Positives = 35/54 (64%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  T+R  D L   + + +F  +++HGD  Q+EREV +R F+TG + +L+ T
Sbjct: 412 LVFVETKRGADTLENWLCMNEFPATSIHGDRTQQEREVALRSFKTGRTPILVAT 465



 Score = 31.9 bits (69), Expect = 0.43
 Identities = 11/24 (45%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V+ V+N+DLP++ ++Y
Sbjct: 469 ARGLDIPHVAHVVNFDLPNDIDDY 492


>At2g45810.1 68415.m05697 DEAD/DEAH box helicase, putative
          Length = 528

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 26/83 (31%), Positives = 44/83 (53%)
 Frame = +2

Query: 5   TRFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           T++Y  +E E  K+  L  L+  L I Q++IFCN+  +V+ L + +    ++   +H  M
Sbjct: 367 TQYYAFVE-ERQKVHCLNTLFSKLQINQSIIFCNSVNRVELLAKKITELGYSCFYIHAKM 425

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            Q  R  +   FR G+ R L+ T
Sbjct: 426 VQDHRNRVFHDFRNGACRNLVCT 448



 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 24/70 (34%), Positives = 30/70 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           L  RGID+Q V+ VIN+D P   E+Y                 N VT  DR  +   E  
Sbjct: 450 LFTRGIDIQAVNVVINFDFPRTSESYLHRVGRSGRFGHLGLAVNLVTYEDRFKMYQTEQE 509

Query: 436 YHTSIVEMPS 465
             T I  +PS
Sbjct: 510 LGTEIKPIPS 519


>At3g58570.1 68416.m06528 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 646

 Score = 48.4 bits (110), Expect = 5e-06
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  ++F  T++  D L   + +  F  + +HGD  Q+EREV +R F+TG + +L+ T
Sbjct: 406 ALTLVFVETKKGADSLENWLCINGFPATTIHGDRSQQEREVALRSFKTGRTPILVAT 462



 Score = 31.9 bits (69), Expect = 0.43
 Identities = 11/24 (45%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V+ V+N+DLP++ ++Y
Sbjct: 466 ARGLDIPHVAHVVNFDLPNDIDDY 489


>At2g47330.1 68415.m05908 DEAD/DEAH box helicase, putative similar
           to RNA helicase [Rattus norvegicus] GI:897915; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 760

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 24/72 (33%), Positives = 38/72 (52%)
 Frame = +2

Query: 38  WKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQ 217
           W LE L  + D       ++F + +  VD +   + L  F V+A+HGD DQ  R   +++
Sbjct: 462 WLLEKLPGMIDE---GDVLVFASKKATVDEIEAQLTLNSFKVAALHGDKDQASRMETLQK 518

Query: 218 FRTGSSRVLITT 253
           F++G   VLI T
Sbjct: 519 FKSGVHHVLIAT 530



 Score = 27.5 bits (58), Expect = 9.3
 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 5/32 (15%)
 Frame = +1

Query: 247 HHCLLA-----RGIDVQQVSCVINYDLPSNRE 327
           HH L+A     RG+D++ +  V+NYD+  + +
Sbjct: 524 HHVLIATDVAARGLDIKSLKTVVNYDIAKDMD 555


>At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to
           SP|O00571 DEAD-box protein 3 (Helicase-like protein 2)
           {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo
           sapiens] GI:3523150; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 633

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 19/57 (33%), Positives = 35/57 (61%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           A  ++F  T+R  D L   + +  F  +++HGD  Q+EREV ++ F++G + +L+ T
Sbjct: 419 ALTLVFVETKRGADSLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVAT 475



 Score = 31.9 bits (69), Expect = 0.43
 Identities = 11/24 (45%), Positives = 20/24 (83%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V+ V+N+DLP++ ++Y
Sbjct: 479 ARGLDIPHVAHVVNFDLPNDIDDY 502


>At2g33730.1 68415.m04134 DEAD box RNA helicase, putative similar to
           SP|P23394 Pre-mRNA splicing factor RNA helicase PRP28
           {Saccharomyces cerevisiae}; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 733

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 22/80 (27%), Positives = 40/80 (50%)
 Frame = +2

Query: 14  YIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQR 193
           ++ +  E  K   L  L D L    A++F NT++  D + +++    + V+ +HG   Q 
Sbjct: 554 HVIMMKESEKFFRLQKLLDELGEKTAIVFVNTKKNCDSIAKNLDKAGYRVTTLHGGKSQE 613

Query: 194 EREVIMRQFRTGSSRVLITT 253
           +RE+ +  FR     VL+ T
Sbjct: 614 QREISLEGFRAKRYNVLVAT 633



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 20/73 (27%), Positives = 33/73 (45%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ++ RGID+  V+ VINYD+P + E Y                 +F+T  D     D++  
Sbjct: 635 VVGRGIDIPDVAHVINYDMPKHIEMYTHRIGRTGRAGKSGVATSFLTLHDTEVFYDLKQM 694

Query: 436 YHTSIVEMPSDVA 474
              S   +P ++A
Sbjct: 695 LVQSNSAVPPELA 707


>At5g11200.1 68418.m01309 DEAD/DEAH box helicase, putative
          Length = 427

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIED 432
           L+ RGID+++V+ VINYD+P + + Y                  FV  A D   L  +++
Sbjct: 347 LVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQE 406

Query: 433 FYHTSIVEMPSDV 471
            +   I E+P  +
Sbjct: 407 RFEVDIKELPEQI 419


>At5g11170.2 68418.m01306 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 344

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIED 432
           L+ RGID+++V+ VINYD+P + + Y                  FV  A D   L  +++
Sbjct: 264 LVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQE 323

Query: 433 FYHTSIVEMPSDV 471
            +   I E+P  +
Sbjct: 324 RFEVDIKELPEQI 336


>At5g11170.1 68418.m01305 DEAD/DEAH box helicase, putative (RH15)
           DEAD BOX RNA helicase RH15, Arabidopsis thaliana,
           EMBL:ATH010466
          Length = 427

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 1/73 (1%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEA-DRRALKDIED 432
           L+ RGID+++V+ VINYD+P + + Y                  FV  A D   L  +++
Sbjct: 347 LVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQE 406

Query: 433 FYHTSIVEMPSDV 471
            +   I E+P  +
Sbjct: 407 RFEVDIKELPEQI 419


>At1g55150.1 68414.m06298 DEAD box RNA helicase, putative (RH20)
           similar to ethylene-responsive RNA helicase GI:5669638
           from [Lycopersicon esculentum]; contains Pfam profiles
           PF00270: DEAD/DEAH box helicase, PF00271: Helicase
           conserved C-terminal domain
          Length = 501

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 17/64 (26%), Positives = 38/64 (59%)
 Frame = +2

Query: 62  LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRV 241
           L D +  ++ ++F +T++  D +T  + +  +   ++HGD  Q ER+ ++ +FR+G S +
Sbjct: 338 LEDIMDGSRILVFLDTKKGCDQITRQLRMDGWPALSIHGDKSQAERDWVLSEFRSGKSPI 397

Query: 242 LITT 253
           +  T
Sbjct: 398 MTAT 401



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 20/73 (27%), Positives = 35/73 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+ V  VINYD P + E+Y                  F T A+ R  K++ +   
Sbjct: 405 ARGLDVKDVKYVINYDFPGSLEDYVHRIGRTGRAGAKGTAYTFFTVANARFAKELTNILQ 464

Query: 442 TSIVEMPSDVANL 480
            +  ++  ++A++
Sbjct: 465 EAGQKVSPELASM 477


>At1g12770.1 68414.m01482 DEAD/DEAH box helicase family protein /
           pentatricopeptide (PPR) repeat-containing protein
           contains Pfam profiles:  PF00271 helicase conserved
           C-terminal domain, PF01535 PPR repeat, PF00270:
           DEAD/DEAH box helicase
          Length = 1145

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 20/81 (24%), Positives = 39/81 (48%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMD 187
           + Y  I   + K++TL      L     + F N  R++  +   +  R    + MHGD+ 
Sbjct: 383 KHYYCISKHQHKVDTLRRCVHALDAQSVIAFMNHSRQLKDVVYKLEARGMNSAEMHGDLG 442

Query: 188 QREREVIMRQFRTGSSRVLIT 250
           +  R  ++++F+ G  +VL+T
Sbjct: 443 KLGRSTVLKKFKNGEIKVLVT 463



 Score = 28.3 bits (60), Expect = 5.3
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L ARG+DV +   V+N +LP++  +Y
Sbjct: 466 LSARGLDVAECDLVVNLELPTDAVHY 491


>At3g09720.1 68416.m01151 DEAD/DEAH box helicase, putative similar
           to RNA helicase involved in rRNA processing GB:6321267
           from [Saccharomyces cerevisiae]c, ontains DEAD and DEAH
           box domain
          Length = 541

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 23/75 (30%), Positives = 37/75 (49%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           ++ARG+D + ++CVINYD P +   Y                  F TE D   L++I + 
Sbjct: 439 VIARGMDFKGINCVINYDFPDSASAYIHRIGRSGRAGRSGEAITFYTEQDVPFLRNIANT 498

Query: 436 YHTSIVEMPSDVANL 480
             +S  E+PS + +L
Sbjct: 499 MMSSGCEVPSWIMSL 513



 Score = 35.5 bits (78), Expect = 0.035
 Identities = 21/74 (28%), Positives = 32/74 (43%)
 Frame = +2

Query: 32  EEWKLETLCDLYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIM 211
           EE KL  L   +        +IF  ++ +   L + +   +     +H D+   ERE  +
Sbjct: 364 EEGKLLALRQSFAESLNPPVLIFVQSKERAKELYDELKCENIRAGVIHSDLPPGERENAV 423

Query: 212 RQFRTGSSRVLITT 253
            QFR G   VLI T
Sbjct: 424 DQFRAGEKWVLIAT 437


>At5g63120.2 68418.m07924 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 591

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 17/57 (29%), Positives = 34/57 (59%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IF  T+R  D +T  + +  +   A+HGD  Q ER+ ++ +F++G S ++  T
Sbjct: 411 SKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPIMTAT 467



 Score = 38.3 bits (85), Expect = 0.005
 Identities = 13/24 (54%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+DV+ + CV+NYD P+  E+Y
Sbjct: 471 ARGLDVKDIKCVVNYDFPNTLEDY 494


>At5g63120.1 68418.m07925 ethylene-responsive DEAD box RNA helicase,
           putative (RH30) strong similarity to ethylene-responsive
           RNA helicase [Lycopersicon esculentum] GI:5669638;
           contains Pfam profiles PF00270: DEAD/DEAH box helicase,
           PF00271: Helicase conserved C-terminal domain
          Length = 484

 Score = 42.7 bits (96), Expect = 2e-04
 Identities = 17/57 (29%), Positives = 34/57 (59%)
 Frame = +2

Query: 83  AQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++ +IF  T+R  D +T  + +  +   A+HGD  Q ER+ ++ +F++G S ++  T
Sbjct: 411 SKILIFVETKRGCDQVTRQLRMDGWPALAIHGDKTQSERDRVLAEFKSGRSPIMTAT 467


>At5g51280.1 68418.m06357 DEAD-box protein abstrakt, putative 
          Length = 591

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/54 (35%), Positives = 29/54 (53%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IFC  +  VD + E + L+     A+HG  DQ +RE  +  F+ G   VL+ T
Sbjct: 401 LIFCENKADVDDIHEYLLLKGVEAVAIHGGKDQEDREYAISSFKAGKKDVLVAT 454



 Score = 31.1 bits (67), Expect = 0.76
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   +  VINYD+P+  ENY
Sbjct: 458 SKGLDFPDIQHVINYDMPAEIENY 481


>At3g22330.1 68416.m02820 DEAD box RNA helicase, putative similar to
           RNA helicases GI:3775995, GI:3775987 from [Arabidopsis
           thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 616

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/56 (33%), Positives = 32/56 (57%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R  D L+ ++  R F   A+HGD+ Q +RE  +  FR G   +L+ T
Sbjct: 351 KCIVFTQTKRDADRLSYAL-ARSFKCEALHGDISQSQRERTLAGFRDGHFNILVAT 405



 Score = 36.7 bits (81), Expect = 0.015
 Identities = 20/68 (29%), Positives = 31/68 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV  V  +I+Y+LP+N E +                    ++   RA+K IE    
Sbjct: 409 ARGLDVPNVDLIIHYELPNNTETFVHRTGRTGRAGKKGSAILIYSQDQSRAVKIIEREVG 468

Query: 442 TSIVEMPS 465
           +   E+PS
Sbjct: 469 SRFTELPS 476


>At4g37020.1 68417.m05244 expressed protein
          Length = 212

 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 21/75 (28%), Positives = 46/75 (61%), Gaps = 4/75 (5%)
 Frame = +2

Query: 11  FYIAIELEEWKLETLCDLYDTLS---IAQAVIFCNTRRKVDWLTESMH-LRDFTVSAMHG 178
           FY+A++  ++K+ET+ +L   L        V+ C++R ++D +  S+  L   +++A++ 
Sbjct: 23  FYLAVDRPQFKMETVVELLGVLGRRPWLPIVVCCSSRDELDAVCSSLSTLPYISLAALYS 82

Query: 179 DMDQREREVIMRQFR 223
           D+  RER +++ +FR
Sbjct: 83  DLADRERAMVIEKFR 97



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/76 (25%), Positives = 32/76 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           LL+ G        +INY+LP+ +E Y                 N V   +   LK +E+ 
Sbjct: 139 LLSSGESSLSARVLINYELPTKKETY--TRRITTCLASGGIVINMVVGGEVTTLKSLEES 196

Query: 436 YHTSIVEMPSDVANLI 483
               I EMP +++ ++
Sbjct: 197 SGILIAEMPINISEIL 212


>At3g53110.1 68416.m05853 DEAD/DEAH box helicase, putative RNA
           helicase, Mus musculus, PIR:I49731
          Length = 496

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 19/83 (22%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +2

Query: 8   RFYIAIELEEWKLETLCD-LYDTLSIAQAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDM 184
           ++ +    E+ K+E + D + +   I Q +IF  T+     + +++    + V+++HG++
Sbjct: 315 QYKVVCPKEQNKIEVIKDQIMELGDIGQTIIFVKTKASAQKVHKALAEMGYDVTSVHGNL 374

Query: 185 DQREREVIMRQFRTGSSRVLITT 253
            + +R+ I+++F+   ++VLI T
Sbjct: 375 TESDRDKIVKEFKECLTQVLIAT 397



 Score = 31.5 bits (68), Expect = 0.57
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRE 327
           ++ARG D Q+V+ V+NY+LP+  E
Sbjct: 399 VIARGFDQQRVNLVVNYNLPTKYE 422


>At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA
           helicase DBP2 - Saccharomyces cerevisiae, PID:g5272
          Length = 542

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 18/54 (33%), Positives = 29/54 (53%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +IFC  +  VD + E + L+     A+HG  DQ +R+  +  F+ G   VL+ T
Sbjct: 352 LIFCENKADVDDIHEYLLLKGVEAVAIHGGKDQEDRDYAISLFKAGKKDVLVAT 405



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ++G+D   +  VINYD+P   ENY
Sbjct: 409 SKGLDFPDIQHVINYDMPGEIENY 432


>At5g26742.1 68418.m03161 DEAD box RNA helicase (RH3) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:3775987; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain, PF00098: Zinc knuckle
          Length = 747

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 1/85 (1%)
 Frame = +2

Query: 2   GTRFYIAIELEEWKLETLCDLYDTLSIA-QAVIFCNTRRKVDWLTESMHLRDFTVSAMHG 178
           G + Y        K   L DL    +   + ++F  T+R  D ++ ++        A+HG
Sbjct: 324 GIKLYAIATTSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALS-NSIATEALHG 382

Query: 179 DMDQREREVIMRQFRTGSSRVLITT 253
           D+ Q +RE  +  FR G   VL+ T
Sbjct: 383 DISQHQRERTLNAFRQGKFTVLVAT 407



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+  V  VI+Y+LP++ E +
Sbjct: 411 SRGLDIPNVDLVIHYELPNDPETF 434


>At1g77050.1 68414.m08971 DEAD/DEAH box helicase, putative similar
           to RNA helicase GI:3776027 from [Arabidopsis thaliana]
          Length = 513

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 18/56 (32%), Positives = 32/56 (57%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q +IF +T+  V+++     L +   S  +GDMDQ  R++ + +FR   + +LI T
Sbjct: 273 QTLIFVSTKHHVEFVNSLFKLENIEPSVCYGDMDQDARKIHVSRFRARKTMLLIVT 328



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 17/71 (23%), Positives = 29/71 (40%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           + ARGID+  +  VIN+D P   + +                 +FVT  D   + D+  F
Sbjct: 330 IAARGIDIPLLDNVINWDFPPRPKIFVHRVGRAARAGRTGCAYSFVTPEDMPYMLDLHLF 389

Query: 436 YHTSIVEMPSD 468
               +   P++
Sbjct: 390 LSKPVRPAPTE 400


>At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9)
           similar to RNA helicases GI:3775995, GI:3775987
           [Arabidopsis thaliana]; contains Pfam profiles PF00270:
           DEAD/DEAH box helicase, PF00271: Helicase conserved
           C-terminal domain
          Length = 610

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 17/56 (30%), Positives = 31/56 (55%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           + ++F  T+R  D L   +  + +   A+HGD+ Q +RE  +  FR G+  +L+ T
Sbjct: 363 KCIVFTQTKRDADRLAFGL-AKSYKCEALHGDISQAQRERTLAGFRDGNFSILVAT 417



 Score = 35.5 bits (78), Expect = 0.035
 Identities = 24/78 (30%), Positives = 34/78 (43%)
 Frame = +1

Query: 232 FSCLDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRR 411
           FS L    + ARG+DV  V  VI+Y+LP+N E +                     +   R
Sbjct: 411 FSILVATDVAARGLDVPNVDLVIHYELPNNTETFVHRTGRTGRAGKKGSAILIHGQDQTR 470

Query: 412 ALKDIEDFYHTSIVEMPS 465
           A+K IE    +   E+PS
Sbjct: 471 AVKMIEKEVGSRFNELPS 488


>At3g09620.1 68416.m01141 DEAD/DEAH box helicase, putative similar
           to RNA helicase GB:A57514 GI:897915 from [Rattus
           norvegicus]; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 989

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 19/70 (27%), Positives = 33/70 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
           ARG+DV+++  V+N+D P++ E+Y                  F++E D +   D+     
Sbjct: 675 ARGLDVKELELVVNFDAPNHYEDYVHRVGRTGRAGRKGCAVTFISEDDAKYAPDLVKALE 734

Query: 442 TSIVEMPSDV 471
            S   +P DV
Sbjct: 735 LSEQPVPDDV 744


>At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to
            RNA helicase [Rattus norvegicus] GI:897915; contains Pfam
            profiles PF00270: DEAD/DEAH box helicase, PF00271:
            Helicase conserved C-terminal domain
          Length = 1166

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 20/76 (26%), Positives = 35/76 (46%)
 Frame = +1

Query: 262  ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDFYH 441
            ARG+DV+++  V+N+D P++ E+Y                  F++E D +   D+     
Sbjct: 837  ARGLDVKELELVVNFDAPNHYEDYVHRVGRTGRAGRKGCAVTFISEDDAKYAPDLVKALE 896

Query: 442  TSIVEMPSDVANLI*G 489
             S   +P D+  L  G
Sbjct: 897  LSEQPVPDDLKALADG 912



 Score = 32.3 bits (70), Expect = 0.33
 Identities = 15/54 (27%), Positives = 26/54 (48%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F  ++ K D L   M    +   ++HG  DQ +RE  +  F+     +LI T
Sbjct: 780 LVFVQSQEKCDALYRDMIKSSYPCLSLHGGKDQTDRESTISDFKNDVCNLLIAT 833


>At3g18600.1 68416.m02364 DEAD/DEAH box helicase, putative
           non-consensus acceptor splice site AT at exon 2; similar
           to DEAD box helicase protein GB:NP_006764 from [Homo
           sapiens], contains Pfam profile: PF00270  DEAD/DEAH box
           helicase
          Length = 568

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 18/54 (33%), Positives = 27/54 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           ++F +T + V + TE M + D  VS +HG MDQ  R      F      +L+ T
Sbjct: 338 MVFFSTCKSVQFHTEIMKISDVDVSDIHGGMDQNRRTKTFFDFMKAKKGILLCT 391


>At1g16280.1 68414.m01949 DEAD/DEAH box helicase, putative similar
           to gb|L13612 DEAD-box protein (dbp45A) from Drosophila
           melanogaster and is a member of PF|00270 DEAD/DEAH box
           helicase family
          Length = 491

 Score = 35.5 bits (78), Expect = 0.035
 Identities = 16/57 (28%), Positives = 27/57 (47%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIED 432
           +RG+D+  V  VINYD+P +  +Y                 + +TE D + +  IE+
Sbjct: 363 SRGLDIPTVDLVINYDIPRDPRDYVHRVGRTARAGRGGLAVSIITETDVKLIHKIEE 419


>At5g60990.1 68418.m07651 DEAD/DEAH box helicase, putative (RH10)
           probable replication protein A1, Oryza sativa,
           EMBL:AF009179
          Length = 456

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           +RG+D+  V  VINYD+P+N ++Y
Sbjct: 321 SRGLDIPSVDVVINYDIPTNSKDY 344


>At3g02065.2 68416.m00170 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 505

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 21/75 (28%), Positives = 32/75 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +L RG+D+  V  VI +D+PS  + Y                  FV E DR    D+   
Sbjct: 417 VLGRGVDLLVVRQVIVFDMPSTIKEYIHVIGRASRMGEKGTAIVFVNEDDRNLFPDLVAA 476

Query: 436 YHTSIVEMPSDVANL 480
             +S   +P ++ NL
Sbjct: 477 LKSSGAAIPKELINL 491



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHL-RDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           AV++ ++R   D L  ++ +       ++HG+   +ER  +M  F  G   VL++T
Sbjct: 360 AVVYVSSRVGADLLANAITVVTGVKALSIHGEKPMKERRDVMGSFLGGEVPVLVST 415


>At3g02065.1 68416.m00171 DEAD/DEAH box helicase family protein
           contains Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 368

 Score = 34.7 bits (76), Expect = 0.062
 Identities = 21/75 (28%), Positives = 32/75 (42%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDIEDF 435
           +L RG+D+  V  VI +D+PS  + Y                  FV E DR    D+   
Sbjct: 280 VLGRGVDLLVVRQVIVFDMPSTIKEYIHVIGRASRMGEKGTAIVFVNEDDRNLFPDLVAA 339

Query: 436 YHTSIVEMPSDVANL 480
             +S   +P ++ NL
Sbjct: 340 LKSSGAAIPKELINL 354



 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
 Frame = +2

Query: 89  AVIFCNTRRKVDWLTESMHL-RDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           AV++ ++R   D L  ++ +       ++HG+   +ER  +M  F  G   VL++T
Sbjct: 223 AVVYVSSRVGADLLANAITVVTGVKALSIHGEKPMKERRDVMGSFLGGEVPVLVST 278


>At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)
           identical to cDNA DEAD box RNA helicase, RH28 GI:3776026
          Length = 789

 Score = 34.3 bits (75), Expect = 0.081
 Identities = 19/55 (34%), Positives = 25/55 (45%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALKDI 426
           ARG+D+  V  VINY  P   ++Y                  FVT++DR  LK I
Sbjct: 473 ARGLDIIGVQTVINYACPREIDSYVHRVGRTARAGREGYAVTFVTDSDRSLLKVI 527


>At5g62190.1 68418.m07807 DEAD box RNA helicase (PRH75) nearly
           identical to RNA helicase [Arabidopsis thaliana]
           GI:1488521; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain
          Length = 671

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 20/56 (35%), Positives = 31/56 (55%)
 Frame = +2

Query: 86  QAVIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           Q +IF  T+ +V   +E   L D +  A+HG++ Q +REV +  FR G    L+ T
Sbjct: 352 QTIIFAETKVQV---SELSGLLDGS-RALHGEIPQSQREVTLAGFRNGKFATLVAT 403


>At1g60930.1 68414.m06858 DNA helicase, putative strong similarity
           to DNA Helicase recQl4B [Arabidopsis thaliana]
           GI:11121451; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain, PF00570: HRDC domain
          Length = 1024

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 13/55 (23%), Positives = 28/55 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTV 256
           +I+C +R   + +TE++ +     +  HG MD  +R  + +Q+      ++  TV
Sbjct: 630 IIYCLSRMDCEKVTEALRVFGHKAAFYHGSMDPGKRAFVQKQWSKDEINIICATV 684


>At3g16840.1 68416.m02150 DEAD/DEAH box helicase, putative (RH13)
           similar to RNA helicase GB:CAA09204 from [Arabidopsis
           thaliana]; identical to cDNA DEAD box RNA helicase, RH13
           GI:3776002
          Length = 832

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           L+ARGID++ V  +I+Y LP + E Y
Sbjct: 561 LVARGIDIKNVRTIIHYKLPHSAEVY 586


>At1g31360.1 68414.m03838 DNA helicase, putative (RECQl2) nearly
           identical to DNA Helicase [Arabidopsis thaliana]
           GI:11121445
          Length = 705

 Score = 31.9 bits (69), Expect = 0.43
 Identities = 12/55 (21%), Positives = 28/55 (50%)
 Frame = +2

Query: 92  VIFCNTRRKVDWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITTV 256
           +++C +R++ + +   +  R  +    H DMD   RE +  ++     +V++ TV
Sbjct: 317 IVYCFSRKECEQIAGDLRERGISADYYHADMDANMREKVHMRWSKNKLQVIVGTV 371


>At5g08620.1 68418.m01025 DEAD box RNA helicase (RH25) identical to
           RNA helicase [Arabidopsis thaliana] GI:3776023; contains
           Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271:
           Helicase conserved C-terminal domain
          Length = 563

 Score = 31.1 bits (67), Expect = 0.76
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D   VS V+   LPS+RE Y
Sbjct: 399 ARGVDYPDVSLVVQMGLPSDREQY 422


>At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong
           similarity to RNA helicase RH26 [Arabidopsis thaliana]
           GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH26
           GI:3776024
          Length = 850

 Score = 31.1 bits (67), Expect = 0.76
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D   VS V+   LPS+RE Y
Sbjct: 701 ARGVDYPDVSLVVQMGLPSDREQY 724


>At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)
           identical to cDNA DEAD box RNA helicase, RH16 GI:3776006
          Length = 626

 Score = 31.1 bits (67), Expect = 0.76
 Identities = 16/65 (24%), Positives = 28/65 (43%)
 Frame = +1

Query: 241 LDHHCLLARGIDVQQVSCVINYDLPSNRENYXXXXXXXXXXXXXXXXXNFVTEADRRALK 420
           LD    + RGID ++V  VIN+D+P +   Y                 + ++  +    +
Sbjct: 390 LDAEFGVVRGIDFKKVHTVINFDMPQSVTGYIHRIGRTGRAYSSGSSVSLISPDEMEGFE 449

Query: 421 DIEDF 435
           DI+ F
Sbjct: 450 DIKSF 454


>At1g71370.1 68414.m08239 DEAD/DEAH box helicase, putative similar
           to ATP-dependent RNA helicase GB:6321111 from (S.
           cerevisiae)
          Length = 558

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 4/58 (6%)
 Frame = +2

Query: 92  VIFCNTRRKVDW----LTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           V+F  T   VD+    L++   L+  +  + HG MDQ+ R+  +  F   SS VL+ T
Sbjct: 269 VVFFMTCACVDYWGLVLSKIPTLKSISFFSTHGKMDQKGRDTALASFTEASSGVLLCT 326


>At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein
           helicase, putative 
          Length = 2172

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
 Frame = +2

Query: 173 HGDMDQREREVIMRQFRTGSSRVLIT--TVYWHVVLMYSKFPASSTMICHP 319
           H  + + +RE++  QFR G+ +VLI+  T+ W V L         T + +P
Sbjct: 811 HAGLTRTDREIVENQFRWGNLQVLISTATLAWGVNLPAHTVIIKGTQVYNP 861


>At2g40700.1 68415.m05021 DEAD/DEAH box helicase, putative (RH17)
           identical to GB:CAA09207, contains a DEAD/DEAH box
           family ATP-dependent helicas signature; identical to
           cDNA DEAD box RNA helicase, RH17 GI:3776008
          Length = 609

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D  +V C+I YD P     Y
Sbjct: 410 ARGLDFPKVRCIIQYDCPGEATEY 433


>At1g31970.1 68414.m03931 DEAD/DEAH box helicase, putative similar
           to p68 RNA helicase [Schizosaccharomyces pombe]
           GI:173419
          Length = 537

 Score = 30.3 bits (65), Expect = 1.3
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D+  V  VINY  P   E+Y
Sbjct: 427 ARGLDIPDVEVVINYTFPLTTEDY 450


>At5g01710.1 68418.m00088 expressed protein
          Length = 513

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 15/37 (40%), Positives = 23/37 (62%)
 Frame = +2

Query: 122 DWLTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGS 232
           DWL +S+  RDF V  M  D++  E ++I R  +TG+
Sbjct: 426 DWLKKSVRERDFVVMKM--DVEGTEFDLIPRLIKTGA 460


>At4g15850.1 68417.m02410 DEAD/DEAH box helicase, putative similar
           to D-E-A-D box protein [Drosophila melanogaster]
           GI:499204; contains Pfam profiles PF00270: DEAD/DEAH box
           helicase, PF00271: Helicase conserved C-terminal domain
          Length = 512

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 12/19 (63%), Positives = 16/19 (84%)
 Frame = +1

Query: 259 LARGIDVQQVSCVINYDLP 315
           L RG+DV+ V+ VINYD+P
Sbjct: 388 LTRGMDVKGVTNVINYDMP 406


>At1g71280.1 68414.m08226 DEAD/DEAH box helicase, putative contains
           Pfam profile: PF00270 DEAD/DEAH box helicase
          Length = 465

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 4/58 (6%)
 Frame = +2

Query: 92  VIFCNTRRKVDW----LTESMHLRDFTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           V+F  T   VD+    +++   L+  +    HG MDQ+ R+  +  F   SS VL+ T
Sbjct: 242 VVFFMTCACVDYWGLVISKIPSLKSISFFPTHGKMDQKGRDTALASFTEASSGVLLCT 299


>At5g15390.1 68418.m01800 tRNA/rRNA methyltransferase (SpoU) family
           protein similar to SP|P19396 tRNA
           (Guanosine-2'-O-)-methyltransferase (EC 2.1.1.34)
           {Escherichia coli O157:H7}; contains Pfam profile
           PF00588: SpoU rRNA Methylase (RNA methyltransferase,
           TrmH) family
          Length = 350

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 11/29 (37%), Positives = 17/29 (58%)
 Frame = +2

Query: 173 HGDMDQREREVIMRQFRTGSSRVLITTVY 259
           HGD+ + E+E++M +F    SR  I   Y
Sbjct: 309 HGDLSEAEKEILMAEFSLRHSRSSICIAY 337


>At2g01440.1 68415.m00067 ATP-dependent DNA helicase, putative 
          Length = 953

 Score = 28.7 bits (61), Expect = 4.0
 Identities = 9/33 (27%), Positives = 21/33 (63%)
 Frame = +2

Query: 155 FTVSAMHGDMDQREREVIMRQFRTGSSRVLITT 253
           +    +HG M   ++E  + +FR+G +++L++T
Sbjct: 797 YNCGLLHGRMKSDDKEEALNKFRSGETQILLST 829


>At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong
           similarity to RNA helicase RH25 [Arabidopsis thaliana]
           GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH
           box helicase, PF00271: Helicase conserved C-terminal
           domain; identical to cDNA DEAD box RNA helicase, RH31
           GI:3776030
          Length = 522

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +1

Query: 262 ARGIDVQQVSCVINYDLPSNRENY 333
           ARG+D   V+ V+   LP +RE Y
Sbjct: 373 ARGVDYPDVTLVLQVGLPKDREQY 396


>At5g19210.2 68418.m02287 DEAD/DEAH box helicase, putative
           EUKARYOTIC INITIATION FACTOR 4A-II (EIF-4A-II), Homo
           sapiens, SWISSPROT:IF42_HUMAN
          Length = 472

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           + ARGID+ + + + N+DLP    +Y
Sbjct: 400 IAARGIDLPETTHIFNFDLPQTVTDY 425


>At5g19210.1 68418.m02288 DEAD/DEAH box helicase, putative
           EUKARYOTIC INITIATION FACTOR 4A-II (EIF-4A-II), Homo
           sapiens, SWISSPROT:IF42_HUMAN
          Length = 315

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +1

Query: 256 LLARGIDVQQVSCVINYDLPSNRENY 333
           + ARGID+ + + + N+DLP    +Y
Sbjct: 243 IAARGIDLPETTHIFNFDLPQTVTDY 268


>At4g01760.1 68417.m00229 DC1 domain-containing protein similar to
           T15B16.10 similar to A. thaliana CHP-rich proteins
           encoded by T10M13, GenBank accession number AF001308
          Length = 667

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +1

Query: 4   HEILHCN*IRRMEAGNSV*PV*YTVYCTSCNFLQHPSQG 120
           H ++ CN +RR +    +  +    YCT+C+F  H   G
Sbjct: 14  HLMMPCNDLRRGDCCERLEAISDGYYCTTCDFFVHKKCG 52


>At5g42120.1 68418.m05128 lectin protein kinase family protein
           contains Pfam domains PF00139: Legume lectins beta
           domain and PF00069: Protein kinase domain
          Length = 691

 Score = 27.5 bits (58), Expect = 9.3
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -1

Query: 211 HDHFTLTLIHVSMHSRYSKVTQMHRFSEPIHLAT 110
           H H++L + H+ +       T  HRFS P+   T
Sbjct: 3   HHHYSLVIFHLILFLSLDFPTLSHRFSPPLQNLT 36


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,622,103
Number of Sequences: 28952
Number of extensions: 288354
Number of successful extensions: 715
Number of sequences better than 10.0: 66
Number of HSP's better than 10.0 without gapping: 641
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 704
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1545769616
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -