SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20027
         (779 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g09530.1 68418.m01103 hydroxyproline-rich glycoprotein family...    34   0.092
At1g62480.1 68414.m07050 vacuolar calcium-binding protein-relate...    31   0.65 
At1g06670.1 68414.m00707 DEIH-box RNA/DNA helicase identical to ...    31   0.86 
At3g49990.1 68416.m05466 expressed protein                             30   1.5  
At5g22810.1 68418.m02667 GDSL-motif lipase, putative similar to ...    29   3.5  
At3g50750.1 68416.m05554 brassinosteroid signalling positive reg...    29   3.5  
At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar ...    29   4.6  
At2g45800.1 68415.m05696 LIM domain-containing protein similar t...    29   4.6  
At1g20530.1 68414.m02558 hypothetical protein                          29   4.6  
At5g03380.1 68418.m00291 heavy-metal-associated domain-containin...    28   6.0  
At2g43680.2 68415.m05430 calmodulin-binding family protein simil...    28   6.0  
At2g43680.1 68415.m05429 calmodulin-binding family protein simil...    28   6.0  
At1g76710.2 68414.m08928 SET domain-containing protein (ASHH1) l...    28   6.0  
At1g76710.1 68414.m08927 SET domain-containing protein (ASHH1) l...    28   6.0  
At3g05900.1 68416.m00664 neurofilament protein-related similar t...    28   8.0  
At2g22450.1 68415.m02662 riboflavin biosynthesis protein, putati...    28   8.0  
At1g11700.1 68414.m01343 expressed protein contains Pfam profile...    28   8.0  

>At5g09530.1 68418.m01103 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 370

 Score = 34.3 bits (75), Expect = 0.092
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 2/88 (2%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVK-KIDLAPTVES-DAAAIPEIKTPEAADAPKLA 685
           E SK E P   + E     A  +P + K ++   P V   +A  +PEI+ PE    P+L 
Sbjct: 171 ENSKPEVPKLMETE--KPEAPKVPEIPKPELPKLPEVPKLEAPKVPEIQKPELPKMPELP 228

Query: 686 DNPVDEDKPADISPDAPKAEAKSADDLR 769
             P  +       P+ PK EA    +++
Sbjct: 229 KMPEIQKPELPKLPEVPKLEAPKVPEIQ 256


>At1g62480.1 68414.m07050 vacuolar calcium-binding protein-related
           contains weak similarity to vacuolar calcium binding
           protein [Raphanus sativus] gi|9049359|dbj|BAA99394
          Length = 152

 Score = 31.5 bits (68), Expect = 0.65
 Identities = 22/86 (25%), Positives = 37/86 (43%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 EKKAEPAPVSNDEVPAIPEAKKDDIAPEDSDIAXXXXXXXXXXXXXXXXAKSSEIPDAEA 434
           EK  E    +  E P + E KKD+ AP ++ +                  K  E+ + + 
Sbjct: 61  EKPIEETEEAQVETPEVVEIKKDEEAPVETPVV---VEDESKTEEVVEAKKEEEVEEKKT 117

Query: 435 KSADIKV-EEPAAQPEDSKTEVQATV 509
           + A + V EE   + E+ K  V+A+V
Sbjct: 118 EEAPVVVEEEKKPEAEEEKPAVEASV 143


>At1g06670.1 68414.m00707 DEIH-box RNA/DNA helicase identical to
            DEIH-box RNA/DNA helicase GB:BAA84364 GI:5881579
            [Arabidopsis thaliana]
          Length = 1576

 Score = 31.1 bits (67), Expect = 0.86
 Identities = 23/92 (25%), Positives = 47/92 (51%), Gaps = 8/92 (8%)
 Frame = +2

Query: 521  KEEKPSATDAEGSADSAAIIPNMVK-----KIDLAPTVESDAAAIPEIK---TPEAADAP 676
            K+E  S +  +  ++  +I  N+V       +++AP  ++ AA  PE K   + +     
Sbjct: 1306 KKEPKSVSKLDLGSEKVSIPSNLVNGNEQHDLNIAPGEDASAAKQPEKKRSRSKKRKSGN 1365

Query: 677  KLADNPVDEDKPADISPDAPKAEAKSADDLRL 772
             L    +++ KP+D++ +  + E KSA++L L
Sbjct: 1366 NLDLGKMEKSKPSDLANENEQTEPKSANNLDL 1397


>At3g49990.1 68416.m05466 expressed protein
          Length = 502

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 14/41 (34%), Positives = 23/41 (56%)
 Frame = +3

Query: 417 IPDAEAKSADIKVEEPAAQPEDSKTEVQATVLKFQKKKNLV 539
           +P   A+  D+K E P A+P   KT  Q +  + +++KN V
Sbjct: 422 LPGRRAEQTDVKAEIPKAEPIKRKTHGQESKEEKKERKNAV 462


>At5g22810.1 68418.m02667 GDSL-motif lipase, putative similar to
           EXL3 (GP:15054386) [Arabidopsis thaliana]
          Length = 337

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 16/47 (34%), Positives = 24/47 (51%)
 Frame = -1

Query: 326 IVLFGLWYSGYLVVTNWSRFGFLLSVAAATSVGLTESSILGATSRIG 186
           +V+F ++   Y + T  S FGF  +  A    GL E+SIL     +G
Sbjct: 254 LVVFDIYQPLYDLATRPSEFGFAEARRACCGTGLLETSILCNPKSVG 300


>At3g50750.1 68416.m05554 brassinosteroid signalling positive
           regulator-related contains similarity to BZR1 protein
           [Arabidopsis thaliana] gi|20270971|gb|AAM18490
          Length = 276

 Score = 29.1 bits (62), Expect = 3.5
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 4/71 (5%)
 Frame = +2

Query: 482 FKN*STSYRAEISKEEKPSATDAEGSADSAAIIP---NMVKKIDLAP-TVESDAAAIPEI 649
           F++   SY+A  S    PS T  + +  S  +IP   N+    +LAP  + + A   P I
Sbjct: 103 FQSPIPSYQASPSSSSYPSPTRFDPNQSSTYLIPYLQNLASSGNLAPLRISNSAPVTPPI 162

Query: 650 KTPEAADAPKL 682
            +P  ++ P+L
Sbjct: 163 SSPRRSN-PRL 172


>At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar to
           variable surface lipoprotein Vsp422-3 (GI:15384285)
           [Mycoplasma bovis]; similar to glycine-rich protein
           atGRP-6, Arabidopsis thaliana, PIR:T49893
          Length = 225

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 23/87 (26%), Positives = 34/87 (39%)
 Frame = +2

Query: 452 SGRTSCSA*RFKN*STSYRAEISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDA 631
           SG+ S      K      R ++ +++KPS  D     D       +  + +  P  +  A
Sbjct: 108 SGKQSGGDNPLKEDKPPERDKLPRKDKPSKEDNLLKGDKPVEEDKLPAEEEKPPQKDKPA 167

Query: 632 AAIPEIKTPEAADAPKLADNPVDEDKP 712
               E   P   D P   D PV+EDKP
Sbjct: 168 ----EGHKPPQKDKPAEGDKPVEEDKP 190


>At2g45800.1 68415.m05696 LIM domain-containing protein similar to
           PGPS/D1 [Petunia x hybrida] GI:4105772, LIM domain
           protein PLIM1 [Nicotiana tabacum] GI:5932418; contains
           Pfam profile PF00412: LIM domain
          Length = 226

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 11/17 (64%), Positives = 14/17 (82%)
 Frame = +3

Query: 288 DEVPAIPEAKKDDIAPE 338
           D+  +IPEAK+DD APE
Sbjct: 197 DDTASIPEAKEDDAAPE 213


>At1g20530.1 68414.m02558 hypothetical protein
          Length = 614

 Score = 28.7 bits (61), Expect = 4.6
 Identities = 15/54 (27%), Positives = 24/54 (44%)
 Frame = +2

Query: 599 IDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPDAPKAEAKSAD 760
           ++  P VES+A   PE  +PE+  +     +  D D P     D  + E  + D
Sbjct: 60  VESPPDVESEADESPETYSPESCSSAHSVTSS-DSDLPPKFDSDCEEGEGTNCD 112


>At5g03380.1 68418.m00291 heavy-metal-associated domain-containing
           protein similar to farnesylated protein ATFP2
           [GI:4097545]; contains Pfam profile PF00403:
           Heavy-metal-associated domain
          Length = 392

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/84 (20%), Positives = 36/84 (42%)
 Frame = +2

Query: 512 EISKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADN 691
           ++  + K +     G+ D   +   +  KI   P       A P+ +TP ++   +   +
Sbjct: 53  DVKIDYKSNKLTVIGNVDPVEVRDKVADKIK-RPVELVSTVAPPKKETPPSSGGAEKKPS 111

Query: 692 PVDEDKPADISPDAPKAEAKSADD 763
           P  E+KPA+  P A +   +  ++
Sbjct: 112 PAAEEKPAEKKPAAVEKPGEKKEE 135


>At2g43680.2 68415.m05430 calmodulin-binding family protein similar
           to SF16 protein [Helianthus annuus] GI:560150; contains
           Pfam profile PF00612: IQ calmodulin-binding motif
          Length = 669

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 5/49 (10%)
 Frame = +2

Query: 605 LAPTVESDAAAIPEIKTPEA----ADAPK-LADNPVDEDKPADISPDAP 736
           L+P   S  A +P   +P+     AD P+ L+  P D  KP+  S +AP
Sbjct: 127 LSPKPPSPRAEVPRSLSPKPPSPRADLPRSLSPKPFDRSKPSSASANAP 175


>At2g43680.1 68415.m05429 calmodulin-binding family protein similar
           to SF16 protein [Helianthus annuus] GI:560150; contains
           Pfam profile PF00612: IQ calmodulin-binding motif
          Length = 668

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 5/49 (10%)
 Frame = +2

Query: 605 LAPTVESDAAAIPEIKTPEA----ADAPK-LADNPVDEDKPADISPDAP 736
           L+P   S  A +P   +P+     AD P+ L+  P D  KP+  S +AP
Sbjct: 126 LSPKPPSPRAEVPRSLSPKPPSPRADLPRSLSPKPFDRSKPSSASANAP 174


>At1g76710.2 68414.m08928 SET domain-containing protein (ASHH1) low
           similarity to huntingtin interacting protein 1 [Homo
           sapiens] GI:12697196; contains Pfam profile PF00856: SET
           domain; identical to cDNA ASH1-like protein 1 (ASHH1)
           partial cds GI:15488417
          Length = 492

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 16/65 (24%), Positives = 28/65 (43%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPV 697
           + EEK      E   +S A+  N+ ++ D  PT   +      +KT  + D   L+ N  
Sbjct: 276 TNEEKEKDISTENHLESTAL--NIQQQSDSTPTPMEEDVVTETVKTETSEDMKLLSQNSQ 333

Query: 698 DEDKP 712
           ++  P
Sbjct: 334 EDSSP 338


>At1g76710.1 68414.m08927 SET domain-containing protein (ASHH1) low
           similarity to huntingtin interacting protein 1 [Homo
           sapiens] GI:12697196; contains Pfam profile PF00856: SET
           domain; identical to cDNA ASH1-like protein 1 (ASHH1)
           partial cds GI:15488417
          Length = 492

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 16/65 (24%), Positives = 28/65 (43%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPV 697
           + EEK      E   +S A+  N+ ++ D  PT   +      +KT  + D   L+ N  
Sbjct: 276 TNEEKEKDISTENHLESTAL--NIQQQSDSTPTPMEEDVVTETVKTETSEDMKLLSQNSQ 333

Query: 698 DEDKP 712
           ++  P
Sbjct: 334 EDSSP 338


>At3g05900.1 68416.m00664 neurofilament protein-related similar to
           NF-180 (GI:632549) [Petromyzon marinus] similar to
           Neurofilament triplet H protein (200 kDa neurofilament
           protein) (Neurofilament heavy polypeptide) (NF-H)
           (Swiss-Prot:P12036) [Homo sapiens]
          Length = 673

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
 Frame = +2

Query: 518 SKEEKPSATDAEGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAA--DAPKLADN 691
           SK+EK   T   GSA  +  I + +++ +  P  E++  A   I   E A  +   + D 
Sbjct: 302 SKDEK---TSESGSALCSEEILSTIQESNTDPIKETEGDASYPIDVIEKAITEEKHVVDE 358

Query: 692 PVDEDKPADIS 724
           P +E+KP++ S
Sbjct: 359 PANEEKPSESS 369


>At2g22450.1 68415.m02662 riboflavin biosynthesis protein, putative
           similar to SP|P50855 Riboflavin biosynthesis protein
           ribA [Includes: GTP cyclohydrolase II (EC 3.5.4.25);
           3,4-dihydroxy-2-butanone 4-phosphate synthase (DHBP
           synthase)] {Actinobacillus pleuropneumoniae}; contains
           Pfam profiles PF00925: GTP cyclohydrolase II, PF00926:
           3,4-dihydroxy-2-butanone 4-phosphate synthase
          Length = 476

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 18/64 (28%), Positives = 28/64 (43%)
 Frame = +2

Query: 551 EGSADSAAIIPNMVKKIDLAPTVESDAAAIPEIKTPEAADAPKLADNPVDEDKPADISPD 730
           EG   S++        I+L P + S      E+  P   D+P++ D   D D+P D    
Sbjct: 50  EGDVFSSSKSNGSSMGIELQPDLVSFGTLAAEM-IPTTMDSPEVEDEEFDLDRPTDGFAS 108

Query: 731 APKA 742
            P+A
Sbjct: 109 IPQA 112


>At1g11700.1 68414.m01343 expressed protein contains Pfam profile
           PF04520: Protein of unknown function, DUF584
          Length = 201

 Score = 27.9 bits (59), Expect = 8.0
 Identities = 12/24 (50%), Positives = 14/24 (58%)
 Frame = +1

Query: 115 IVHSLRGCEFGDASGGGKGRIPAQ 186
           IVH +RG   G   GGG GR+  Q
Sbjct: 88  IVHQIRGGGEGGGGGGGGGRVERQ 111


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,507,245
Number of Sequences: 28952
Number of extensions: 244268
Number of successful extensions: 1001
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 952
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 999
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1746037600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -