SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20026
         (735 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ...   202   3e-52
At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,...   118   5e-27
At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E...   105   2e-23
At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide...    73   2e-13
At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,...    64   7e-11
At2g45030.1 68415.m05606 mitochondrial elongation factor, putati...    42   3e-04
At1g45332.1 68414.m05195 mitochondrial elongation factor, putati...    42   3e-04
At1g62750.1 68414.m07082 elongation factor Tu family protein sim...    41   0.001
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    40   0.001
At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    38   0.005
At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2, p...    38   0.009
At5g08650.1 68418.m01029 GTP-binding protein LepA, putative            37   0.012
At1g06220.2 68414.m00656 elongation factor Tu family protein sim...    37   0.016
At1g06220.1 68414.m00655 elongation factor Tu family protein sim...    37   0.016
At4g11160.1 68417.m01808 translation initiation factor IF-2, mit...    33   0.26 
At4g18330.2 68417.m02719 eukaryotic translation initiation facto...    32   0.34 
At4g18330.1 68417.m02718 eukaryotic translation initiation facto...    32   0.34 
At2g18720.1 68415.m02180 eukaryotic translation initiation facto...    32   0.45 
At1g04170.1 68414.m00407 eukaryotic translation initiation facto...    32   0.45 
At5g46180.1 68418.m05680 ornithine aminotransferase, putative / ...    31   1.0  
At1g76825.1 68414.m08940 eukaryotic translation initiation facto...    30   1.8  
At1g76810.1 68414.m08938 eukaryotic translation initiation facto...    30   1.8  
At1g76720.1 68414.m08929 eukaryotic translation initiation facto...    30   1.8  
At1g21160.1 68414.m02646 eukaryotic translation initiation facto...    29   2.4  
At5g17060.1 68418.m01999 ADP-ribosylation factor, putative simil...    28   5.6  
At3g20440.1 68416.m02588 glycoside hydrolase family 13 protein s...    28   5.6  
At3g18350.1 68416.m02334 expressed protein contains Pfam profile...    28   5.6  
At5g51710.1 68418.m06413 K+ efflux antiporter, putative (KEA5) M...    28   7.4  
At1g17220.1 68414.m02098 translation initiation factor IF-2, chl...    28   7.4  
At5g44785.2 68418.m05490 expressed protein contains Pfam PF05329...    27   9.8  
At5g44785.1 68418.m05489 expressed protein contains Pfam PF05329...    27   9.8  
At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha s...    27   9.8  

>At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha
           identical to SWISS-PROT:P13905 elongation factor 1-alpha
           (EF-1-alpha) [Arabidopsis thaliana]
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 99/133 (74%), Positives = 106/133 (79%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  112 bits (270), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 99/133 (74%), Positives = 106/133 (79%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  112 bits (270), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 99/133 (74%), Positives = 106/133 (79%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  112 bits (270), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score =  202 bits (492), Expect = 3e-52
 Identities = 99/133 (74%), Positives = 106/133 (79%)
 Frame = +1

Query: 112 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYW 291
           MGKEK HINIVVIGHVDSGKSTTTGHLIYK GGIDKR IE+FEKEA E  K         
Sbjct: 1   MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL 60

Query: 292 TN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGT 471
              +     GITIDIALWKFET+KYY T+IDAPGHRDFIKNMITGTSQADCAVLI+ + T
Sbjct: 61  DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT 120

Query: 472 GEFEAGISKNGQT 510
           G FEAGISK+GQT
Sbjct: 121 GGFEAGISKDGQT 133



 Score =  112 bits (270), Expect = 2e-25
 Identities = 51/75 (68%), Positives = 62/75 (82%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHALLAFTLGVKQ+I   NKMD+T P YS+ R++EI KEVSSY+KK+GYNP  + FVPI
Sbjct: 134 REHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPI 193

Query: 690 SGWHGDNMLEPSTKM 734
           SG+ GDNM+E ST +
Sbjct: 194 SGFEGDNMIERSTNL 208


>At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,
           putative similar to EF-1-alpha-related GTP-binding
           protein gi|1009232|gb|AAA79032
          Length = 532

 Score =  118 bits (283), Expect = 5e-27
 Identities = 55/130 (42%), Positives = 81/130 (62%)
 Frame = +1

Query: 121 EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN* 300
           +K H+N+V IGHVD+GKST  G +++  G +D R I+K+EKEA++  ++   M       
Sbjct: 98  KKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTN 157

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEF 480
                 G T+++    FET     TI+DAPGH+ ++ NMI+G SQAD  VL+++A  GEF
Sbjct: 158 EEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEF 217

Query: 481 EAGISKNGQT 510
           E G  + GQT
Sbjct: 218 ETGYERGGQT 227



 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAA-VAFVP 686
           REH  LA TLGV +LIV VNKMD     +S+ R++EI++++  ++K  GYN    V F+P
Sbjct: 228 REHVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQKMVPFLKASGYNTKKDVVFLP 287

Query: 687 ISGWHGDNM 713
           ISG  G NM
Sbjct: 288 ISGLMGKNM 296


>At5g10630.1 68418.m01231 elongation factor 1-alpha, putative /
           EF-1-alpha, putative contains similarity to
           SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha)
           [Aeropyrum pernix]
          Length = 667

 Score =  105 bits (253), Expect = 2e-23
 Identities = 50/129 (38%), Positives = 79/129 (61%), Gaps = 1/129 (0%)
 Frame = +1

Query: 127 THINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RL 306
           + +N+ ++GHVDSGKST +G L++  G I ++ + K+EKEA+   K              
Sbjct: 238 SQLNLAIVGHVDSGKSTLSGRLLHLLGRISQKQMHKYEKEAKLQGKGSFAYAWALDESAE 297

Query: 307 SVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEA 486
               GIT+ +A+  F + +++V ++D+PGH+DF+ NMI G +QAD A+L++ A  G FEA
Sbjct: 298 ERERGITMTVAVAYFNSKRHHVVLLDSPGHKDFVPNMIAGATQADAAILVIDASVGAFEA 357

Query: 487 GISK-NGQT 510
           G     GQT
Sbjct: 358 GFDNLKGQT 366



 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 24/69 (34%), Positives = 43/69 (62%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           REHA +    GV+Q+IV +NKMD     YS+ RF+ IK+ V S+++   +  +++ ++P+
Sbjct: 367 REHARVLRGFGVEQVIVAINKMDIVG--YSKERFDLIKQHVGSFLQSCRFKDSSLTWIPL 424

Query: 690 SGWHGDNML 716
           S     N++
Sbjct: 425 SAMENQNLV 433


>At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA)
           identical to SWISS-PROT:P17745 elongation factor Tu,
           chloroplast precursor (EF-Tu) [Arabidopsis thaliana]
          Length = 476

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 43/122 (35%), Positives = 62/122 (50%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGY 288
           K  ++K H+NI  IGHVD GK+T T  L      I     +K++    E    P      
Sbjct: 72  KFERKKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYD----EIDAAPEER--- 124

Query: 289 WTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAG 468
                   + GITI+ A  ++ET   +   +D PGH D++KNMITG +Q D A+L+V+  
Sbjct: 125 --------ARGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGA 176

Query: 469 TG 474
            G
Sbjct: 177 DG 178



 Score = 28.7 bits (61), Expect = 4.2
 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFE-EIKKEVSSY 641
           +EH LLA  +GV  ++V +NK D  +        E E+++ +SSY
Sbjct: 184 KEHILLAKQVGVPDMVVFLNKEDQVDDAELLELVELEVRELLSSY 228


>At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,
           putative similar to mitochondrial elongation factor Tu
           [Arabidopsis thaliana] gi|1149571|emb|CAA61511
          Length = 454

 Score = 64.5 bits (150), Expect = 7e-11
 Identities = 41/119 (34%), Positives = 58/119 (48%)
 Frame = +1

Query: 118 KEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           + K H+N+  IGHVD GK+T T  +        K     F+    E  K P         
Sbjct: 63  RNKPHVNVGTIGHVDHGKTTLTAAITKVLAEEGKAKAIAFD----EIDKAPEEK------ 112

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                  GITI  A  ++ET+K +   +D PGH D++KNMITG +Q D  +L+V+   G
Sbjct: 113 -----KRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSGPDG 166



 Score = 31.5 bits (68), Expect = 0.60
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = +3

Query: 510 REHALLAFTLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPI 689
           +EH LLA  +GV  L+  +NK+D  + P      E   +E+ S+ K  G +   +    +
Sbjct: 172 KEHILLARQVGVPSLVCFLNKVDVVDDPELLELVEMELRELLSFYKFPGDDIPIIRGSAL 231

Query: 690 SGWHGDN 710
           S   G N
Sbjct: 232 SALQGTN 238


>At2g45030.1 68415.m05606 mitochondrial elongation factor, putative
           similar to SP|P25039 Elongation factor G 1,
           mitochondrial precursor (mEF-G-1) {Saccharomyces
           cerevisiae}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03764: Elongation factor
           G domain IV, PF00679: Elongation factor G C-terminus
          Length = 754

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 36/124 (29%), Positives = 53/124 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  +++  G I     E  E   ++ V    + +       L   
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRIH----EIHEVRGRDGVGAKMDSMD------LERE 116

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 495
            GITI  A        Y V IID PGH DF   +       D A+L++ +  G     I+
Sbjct: 117 KGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSIT 176

Query: 496 KNGQ 507
            + Q
Sbjct: 177 VDRQ 180


>At1g45332.1 68414.m05195 mitochondrial elongation factor, putative
           similar to mitochondrial elongation factor GI:3917 from
           [Saccharomyces cerevisiae]
          Length = 754

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 36/124 (29%), Positives = 53/124 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           NI +  H+DSGK+T T  +++  G I     E  E   ++ V    + +       L   
Sbjct: 67  NIGISAHIDSGKTTLTERVLFYTGRIH----EIHEVRGRDGVGAKMDSMD------LERE 116

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGIS 495
            GITI  A        Y V IID PGH DF   +       D A+L++ +  G     I+
Sbjct: 117 KGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSVGGVQSQSIT 176

Query: 496 KNGQ 507
            + Q
Sbjct: 177 VDRQ 180


>At1g62750.1 68414.m07082 elongation factor Tu family protein
           similar to elongation factor G SP:P34811 [Glycine max
           (Soybean)]
          Length = 783

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 33/118 (27%), Positives = 52/118 (44%), Gaps = 1/118 (0%)
 Frame = +1

Query: 124 KTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEA-QEWVKDPSNMLGYWTN* 300
           K + NI ++ H+D+GK+TTT  ++Y  G  + +  E  E  A  +W++            
Sbjct: 94  KDYRNIGIMAHIDAGKTTTTERILYYTGR-NYKIGEVHEGTATMDWMEQEQER------- 145

Query: 301 RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
                 GITI  A       K+ + IID PGH DF   +       D A+ +  +  G
Sbjct: 146 ------GITITSAATTTFWDKHRINIIDTPGHVDFTLEVERALRVLDGAICLFDSVAG 197


>At3g22980.1 68416.m02898 elongation factor Tu family protein
           similar to eukaryotic translation elongation factor 2
           GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 2/115 (1%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGG--IDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLS 309
           NI ++ HVD GK+T   HLI   GG  +  R   K      +++ +              
Sbjct: 11  NICILAHVDHGKTTLADHLIASSGGGVLHPRLAGKLR--FMDYLDEEQRR---------- 58

Query: 310 VSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
               IT+  +    +   Y + +ID+PGH DF   + T    +D A+++V A  G
Sbjct: 59  ---AITMKSSSISLKYKDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAVEG 110


>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 36/127 (28%), Positives = 53/127 (41%), Gaps = 5/127 (3%)
 Frame = +1

Query: 109 KMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDK-----RTIEKFEKEAQEWVKDPS 273
           K   EK   N  +I H+D GKST    L+   G I K     + ++K ++E    VK  +
Sbjct: 60  KFPSEKIR-NFSIIAHIDHGKSTLADRLMELTGTIKKGHGQPQYLDKLQRERGITVKAQT 118

Query: 274 NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVL 453
             + Y              +  +   E S Y + +ID PGH DF   +    S    A+L
Sbjct: 119 ATMFY--------------ENKVEDQEASGYLLNLIDTPGHVDFSYEVSRSLSACQGALL 164

Query: 454 IVAAGTG 474
           +V A  G
Sbjct: 165 VVDAAQG 171


>At1g56070.1 68414.m06438 elongation factor 2, putative / EF-2,
           putative similar to ELONGATION FACTOR 2 GB:O14460 from
           [Schizosaccharomyces pombe]
          Length = 843

 Score = 37.5 bits (83), Expect = 0.009
 Identities = 30/114 (26%), Positives = 49/114 (42%), Gaps = 6/114 (5%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGI------DKRTIEKFEKEAQEWVKDPSNMLGYWTN 297
           N+ VI HVD GKST T  L+   G I      D R  +    EA+  +   S  +  +  
Sbjct: 21  NMSVIAHVDHGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRADEAERGITIKSTGISLYYE 80

Query: 298 *RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
                    ++       + ++Y + +ID+PGH DF   +       D A+++V
Sbjct: 81  -----MTDESLKSFTGARDGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVV 129


>At5g08650.1 68418.m01029 GTP-binding protein LepA, putative
          Length = 681

 Score = 37.1 bits (82), Expect = 0.012
 Identities = 24/113 (21%), Positives = 50/113 (44%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N  +I H+D GKST    L+   G +  R +++   +  +  ++              ++
Sbjct: 88  NFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKEQFLDNMDLERERG------------IT 135

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           + +      + +E + + + +ID PGH DF   +    +  + A+L+V A  G
Sbjct: 136 IKLQAARMRYVYEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQG 188


>At1g06220.2 68414.m00656 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 36.7 bits (81), Expect = 0.016
 Identities = 27/113 (23%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ ++GH+  GK+     L+ +        +  F  + ++ +K     +       +S+ 
Sbjct: 140 NVALVGHLQHGKTVFMDMLVEQT-----HHMSTFNAKNEKHMKYTDTRVDEQER-NISIK 193

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             + + + L    +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 194 A-VPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At1g06220.1 68414.m00655 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 36.7 bits (81), Expect = 0.016
 Identities = 27/113 (23%), Positives = 48/113 (42%)
 Frame = +1

Query: 136 NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLGYWTN*RLSVS 315
           N+ ++GH+  GK+     L+ +        +  F  + ++ +K     +       +S+ 
Sbjct: 140 NVALVGHLQHGKTVFMDMLVEQT-----HHMSTFNAKNEKHMKYTDTRVDEQER-NISIK 193

Query: 316 VGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
             + + + L    +  Y   I+D PGH +F   M      AD AVLIV A  G
Sbjct: 194 A-VPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLIVDAAEG 245


>At4g11160.1 68417.m01808 translation initiation factor IF-2,
           mitochondrial, putative similar to SP|P46198|IF2M_BOVIN
           Translation initiation factor IF-2, mitochondrial
           precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus}
          Length = 743

 Score = 32.7 bits (71), Expect = 0.26
 Identities = 14/35 (40%), Positives = 19/35 (54%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +T +D PGH  F +    G +  D  VL+VAA  G
Sbjct: 270 ITFLDTPGHAAFSEMRARGAAVTDIVVLVVAADDG 304


>At4g18330.2 68417.m02719 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 471

 Score = 32.3 bits (70), Expect = 0.34
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +1

Query: 355 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           T + +V+ +D PGH   +  M+ G +  D A+L++AA
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAA 160


>At4g18330.1 68417.m02718 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 284

 Score = 32.3 bits (70), Expect = 0.34
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +1

Query: 355 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           T + +V+ +D PGH   +  M+ G +  D A+L++AA
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAA 160


>At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative 
          Length = 465

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +1

Query: 367 YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           +V+ +D PGH   +  M+ G +  D A+LI+AA
Sbjct: 120 HVSFVDCPGHDILMATMLNGAAIMDGALLIIAA 152



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 30/113 (26%), Positives = 49/113 (43%)
 Frame = +1

Query: 106 PKMGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEWVKDPSNMLG 285
           P++   +  INI  IGHV  GKST    ++    G+   T+ KF+ E +   ++ +  LG
Sbjct: 25  PEVISRQATINIGTIGHVAHGKST----IVKAVSGV--HTV-KFKSELE---RNITIKLG 74

Query: 286 YWTN*RLSVSVGITIDIALWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADC 444
           Y  N ++         +A   F + K      D  GH  +   ++   S  DC
Sbjct: 75  Y-ANAKIYKCEKCPRPVAYKSFGSGKEDNPSCDVSGHEKYKMKLLRHVSFVDC 126


>At1g04170.1 68414.m00407 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to gb|U37354 from S. pombe. ESTs
           gb|T41979, gb|N37284 and gb|N37529 come from this gene
          Length = 465

 Score = 31.9 bits (69), Expect = 0.45
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 4/43 (9%)
 Frame = +1

Query: 349 FETSKY----YVTIIDAPGHRDFIKNMITGTSQADCAVLIVAA 465
           FE SK     +V+ +D PGH   +  M+ G +  D A+L++AA
Sbjct: 112 FENSKMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAA 154


>At5g46180.1 68418.m05680 ornithine aminotransferase, putative /
           ornithine--oxo-acid aminotransferase, putative similar
           to SP|Q92413 Ornithine aminotransferase (EC 2.6.1.13)
           (Ornithine--oxo-acid aminotransferase) [Aspergillus
           nidulans] {Emericella nidulans}; contains Pfam profile
           PF00202: aminotransferase, class III
          Length = 475

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 17/54 (31%), Positives = 28/54 (51%)
 Frame = +3

Query: 534 TLGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPISG 695
           T GV++   G+ + +S  PP S  R  E++ E S++     Y+P  V F   +G
Sbjct: 18  TAGVRRSYGGLPQSNSKSPPSSSQRLMELESEFSAH----NYHPVPVVFSRANG 67


>At1g76825.1 68414.m08940 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profile PF00009: Elongation
           factor Tu GTP binding domain
          Length = 630

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           +ID PGH  F      G+S  D A+L+V
Sbjct: 113 VIDTPGHESFTNLRSRGSSLCDLAILVV 140


>At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to IF2
           protein [Drosophila melanogaster] GI:7108770; contains
           Pfam profile PF03144: Elongation factor Tu domain 2
          Length = 1294

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           +ID PGH  F      G+S  D A+L+V
Sbjct: 772 VIDTPGHESFTNLRSRGSSLCDLAILVV 799


>At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1201

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +1

Query: 376 IIDAPGHRDFIKNMITGTSQADCAVLIV 459
           +ID PGH  F      G+S  D A+L+V
Sbjct: 705 VIDTPGHESFTNLRSRGSSLCDLAILVV 732


>At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1088

 Score = 29.5 bits (63), Expect = 2.4
 Identities = 11/30 (36%), Positives = 17/30 (56%)
 Frame = +1

Query: 370 VTIIDAPGHRDFIKNMITGTSQADCAVLIV 459
           + +ID PGH  F      G++  D A+L+V
Sbjct: 558 ILVIDTPGHESFTNLRSRGSNLCDLAILVV 587


>At5g17060.1 68418.m01999 ADP-ribosylation factor, putative similar
           to ADP-ribosylation factor 1; ARF 1 (GP:385340)
           {Drosophila melanogaster)
          Length = 192

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = +1

Query: 181 TGHLIYKCGGIDKRTIEKFEKEAQEWVKDP 270
           T  LIY    +D+  I K ++E QE +KDP
Sbjct: 85  TDGLIYVVDSLDRERIGKAKQEFQEIIKDP 114


>At3g20440.1 68416.m02588 glycoside hydrolase family 13 protein
           similar to 1,4-alpha-glucan branching enzyme [Solanum
           tuberosum] GI:1621012, 1,4-alpha-glucan branching enzyme
           (EC 2.4.1.18) from [Homo sapiens] SP|Q04446, {Solanum
           tuberosum} SP|P30924; contains Pfam profiles: PF00128
           Alpha amylase catalytic domain, PF02922 Isoamylase
           N-terminal domain
          Length = 777

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 3/33 (9%)
 Frame = +3

Query: 597 SEPR---FEEIKKEVSSYIKKIGYNPAAVAFVP 686
           SEP+   FEE  K+V  ++K+ GYN   +  VP
Sbjct: 257 SEPKVSTFEEFTKKVLPHVKRAGYNAIQLIGVP 289


>At3g18350.1 68416.m02334 expressed protein contains Pfam profile:
           PF04842 plant protein of unknown function (DUF639)
          Length = 692

 Score = 28.3 bits (60), Expect = 5.6
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 4/55 (7%)
 Frame = +1

Query: 229 EKFEKEAQEWVKDPS----NMLGYWTN*RLSVSVGITIDIALWKFETSKYYVTII 381
           + F++EA E +K PS    N L Y     LS+SVG+T  +A  KF    + + ++
Sbjct: 73  DSFKQEAFESLKQPSLFPRNFLEYCCFRALSLSVGVTGHLADKKFRRLTFDMMVV 127


>At5g51710.1 68418.m06413 K+ efflux antiporter, putative (KEA5)
           Monovalent cation:proton antiporter family 2 (CPA2
           family) member, PMID:11500563; related to
           glutathione-regulated potassium-efflux system protein
           [Escherichia coli] GP|606284|gb|AAA58147
          Length = 568

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 14/37 (37%), Positives = 22/37 (59%)
 Frame = +3

Query: 603 PRFEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNM 713
           PRF ++  ++SS   ++ Y  AAVAF  +S W  D +
Sbjct: 354 PRFLKLMIQLSSQTNEL-YQLAAVAFCLLSAWCSDKL 389


>At1g17220.1 68414.m02098 translation initiation factor IF-2,
           chloroplast, putative similar to SP|P57997|IF2C_PHAVU
           Translation initiation factor IF-2, chloroplast
           precursor (PvIF2cp) {Phaseolus vulgaris}
          Length = 1026

 Score = 27.9 bits (59), Expect = 7.4
 Identities = 12/32 (37%), Positives = 16/32 (50%)
 Frame = +1

Query: 379 IDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 474
           +D PGH  F      G    D A+++VAA  G
Sbjct: 557 LDTPGHEAFGAMRARGARVTDIAIIVVAADDG 588


>At5g44785.2 68418.m05490 expressed protein contains Pfam PF05329:
           Protein of unknown function (DUF731)
          Length = 442

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 579 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 692
           +TE   + P+  E K E+S++I  IG+    V F P S
Sbjct: 63  ATEKESTPPKKIEYKPEISNWINLIGFVEQPVQFGPCS 100


>At5g44785.1 68418.m05489 expressed protein contains Pfam PF05329:
           Protein of unknown function (DUF731)
          Length = 440

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 14/38 (36%), Positives = 21/38 (55%)
 Frame = +3

Query: 579 STEPPYSEPRFEEIKKEVSSYIKKIGYNPAAVAFVPIS 692
           +TE   + P+  E K E+S++I  IG+    V F P S
Sbjct: 63  ATEKESTPPKKIEYKPEISNWINLIGFVEQPVQFGPCS 100


>At2g28000.1 68415.m03393 RuBisCO subunit binding-protein alpha
           subunit, chloroplast / 60 kDa chaperonin alpha subunit /
           CPN-60 alpha identical to SWISS-PROT:P21238- RuBisCO
           subunit binding-protein alpha subunit, chloroplast
           precursor (60 kDa chaperonin alpha subunit, CPN-60
           alpha) [Arabidopsis thaliana]
          Length = 586

 Score = 27.5 bits (58), Expect = 9.8
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = -1

Query: 462 SYDEHSAISLRGSCDHVLDEISVSRSINDGNIVLASFELPESNIDCDTDAHA 307
           ++D+HS  +L+   D + D + ++      N+VL  F  P+   D  T A A
Sbjct: 52  AFDQHSRAALQAGIDKLADCVGLTLGPRGRNVVLDEFGSPKVVNDGVTIARA 103


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,249,591
Number of Sequences: 28952
Number of extensions: 335034
Number of successful extensions: 1105
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 1044
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1090
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1614253080
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -