SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20025
         (696 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g28480.1 68416.m03558 oxidoreductase, 2OG-Fe(II) oxygenase fa...    35   0.059
At1g76470.1 68414.m08895 cinnamoyl-CoA reductase family similar ...    28   6.8  
At1g27620.1 68414.m03373 transferase family protein similar to h...    28   6.8  

>At3g28480.1 68416.m03558 oxidoreductase, 2OG-Fe(II) oxygenase
           family protein similar to prolyl 4-hydroxylase, alpha
           subunit, from Gallus gallus [GI:212530], Rattus
           norvegicus [GI:474940], Mus musculus [SP|Q60715];
           contains PF03171 2OG-Fe(II) oxygenase superfamily domain
          Length = 316

 Score = 34.7 bits (76), Expect = 0.059
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = -2

Query: 299 CPAWKLRGRTRRNPPYSLGQDLPHGVHRENC 207
           C  W   G  ++NP Y +G D  HG  R++C
Sbjct: 281 CEKWAKAGECQKNPTYMVGSDKDHGYCRKSC 311


>At1g76470.1 68414.m08895 cinnamoyl-CoA reductase family similar to
           cinnamoyl-CoA reductase GB:CAA56103 [Eucalyptus gunnii],
           Pinus taeda [GI:17978649]; contains non-consensus GG
           acceptor splice site at exon 4
          Length = 317

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = -3

Query: 217 AKIATEKTALRWYNASFLTLISLCTPLV 134
           AK  TE+ AL W   +F  +++LC  ++
Sbjct: 158 AKTLTEREALEWSKRNFADVVTLCPSVI 185


>At1g27620.1 68414.m03373 transferase family protein similar to
           hypersensitivity-related gene product HSR201 - Nicotiana
           tabacum, EMBL:X95343; contains Pfam transferase family
           domain PF00248
          Length = 442

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 20/69 (28%), Positives = 28/69 (40%), Gaps = 6/69 (8%)
 Frame = -2

Query: 200 KNCAEMVQCXXXXXXXXXXXLGWAGVHDVLILLCVELLH------RLVRHLDEGNIGGGS 39
           K CA  ++C             WA   D+ + + V+LL       RL   L +G  G G 
Sbjct: 248 KTCAPSLKCTTFEALAANTWRSWAQSLDLPMTMLVKLLFSVNMRKRLTPELPQGYYGNGF 307

Query: 38  HGACLQHKV 12
             AC + KV
Sbjct: 308 VLACAESKV 316


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,679,086
Number of Sequences: 28952
Number of extensions: 275637
Number of successful extensions: 698
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 683
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 697
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1487069504
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -