SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20020
         (716 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g00990.1 68417.m00133 transcription factor jumonji (jmjC) dom...    29   4.1  
At2g44670.1 68415.m05559 senescence-associated protein-related s...    28   5.4  
At1g43850.1 68414.m05052 SEUSS transcriptional co-regulator iden...    28   7.1  
At1g22060.1 68414.m02759 expressed protein                             28   7.1  
At5g51330.1 68418.m06364 meiosis protein-related (DYAD) (SWI1) a...    27   9.4  
At5g48335.1 68418.m05971 expressed protein                             27   9.4  
At1g22000.1 68414.m02752 F-box family protein contains F-box dom...    27   9.4  
At1g20060.1 68414.m02511 kinesin motor protein-related                 27   9.4  

>At4g00990.1 68417.m00133 transcription factor jumonji (jmjC)
           domain-containing protein contains Pfam domain, PF02373:
           jmjC domain
          Length = 840

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 16/62 (25%), Positives = 32/62 (51%)
 Frame = +3

Query: 303 VNVRR*NASERLQPIRSFTLKVKRSKRALTSLDSPSFANNAKKQLSAERQRKNLKKILQL 482
           VNV    A   + P++   +KV + K A   L    ++   K+  ++E + K++K++ + 
Sbjct: 553 VNVLTHTAKVEIPPVKYQNIKVHQKKYAEAMLQKQQYSGQVKE--ASELENKSMKEVDES 610

Query: 483 KK 488
           KK
Sbjct: 611 KK 612


>At2g44670.1 68415.m05559 senescence-associated protein-related
           similar to senescence-associated protein SAG102
           (GI:22331931) [Arabidopsis thaliana];
          Length = 93

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 14/28 (50%), Positives = 19/28 (67%), Gaps = 1/28 (3%)
 Frame = +3

Query: 6   RGNRKFTSPEELEEQRKHDEQK-KKWRK 86
           RG++ F S E  EEQ + DE K +KW+K
Sbjct: 37  RGDKAFCSNECREEQIESDEAKERKWKK 64


>At1g43850.1 68414.m05052 SEUSS transcriptional co-regulator
           identical to SEUSS transcriptional co-regulator
           [Arabidopsis thaliana] gi|18033922|gb|AAL57277
          Length = 877

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 15/54 (27%), Positives = 25/54 (46%)
 Frame = +3

Query: 345 IRSFTLKVKRSKRALTSLDSPSFANNAKKQLSAERQRKNLKKILQLKKGRQSSL 506
           + SF      S R+   +    F+N +  QL AE+QR    +    + G+Q S+
Sbjct: 98  LSSFNASSMVSPRSSGQVQGQQFSNVSANQLLAEQQRNKKMETQSFQHGQQQSM 151


>At1g22060.1 68414.m02759 expressed protein
          Length = 1999

 Score = 27.9 bits (59), Expect = 7.1
 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 4/71 (5%)
 Frame = +3

Query: 333  RLQPIR-SFTLKVKRSKRALTSLDSPSFANNAKKQLSAERQRKNLK---KILQLKKGRQS 500
            +LQ ++   T+  K  +  L  L      N A+K+  + + +++ +   KIL+L+  RQS
Sbjct: 1592 KLQELQYQLTMSKKHGEEILMKLQDAIDENEARKKAESSQLKRSKELEGKILELEADRQS 1651

Query: 501  SLY*LQEEISS 533
             +Y  +E+ ++
Sbjct: 1652 VIYDKREKTTA 1662


>At5g51330.1 68418.m06364 meiosis protein-related (DYAD) (SWI1)
           annotation temporarily based on supporting cDNA
           gi|18483289|gb|AF466153.1|; supporting cDNA are SWITCH1
           splice variant S and SWITCH1 splice variant L (SWI1)
           GI:16033413 and GI:16033410
          Length = 639

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 10/23 (43%), Positives = 17/23 (73%)
 Frame = +3

Query: 6   RGNRKFTSPEELEEQRKHDEQKK 74
           +GN+   SP+  E+ RKHD+Q++
Sbjct: 537 KGNQITESPQNREKGRKHDQQER 559


>At5g48335.1 68418.m05971 expressed protein
          Length = 114

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 3/38 (7%)
 Frame = -2

Query: 412 NDGESSE-VSARLLRFTFSVKLLI--GCSRSLAFYLLT 308
           N+GESS+ V+    R   S K++   GCSRS AF LL+
Sbjct: 42  NEGESSQSVAVGFQRENSSPKIISVEGCSRSEAFQLLS 79


>At1g22000.1 68414.m02752 F-box family protein contains F-box domain
           Pfam:PF00646
          Length = 727

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 3/85 (3%)
 Frame = +3

Query: 288 HNCQDVNVRR*NASERLQPIRSFTLKVKRSKRALTSLDSPSFANNAKK--QLSAERQRKN 461
           + C D+  +    SE++     F       +  L  L      N A+K  Q S  ++ K 
Sbjct: 557 NRCSDLTQK---LSEQILKTEEFNAIALHGEELLMKLQDAIDENEARKKAQSSQLKRTKE 613

Query: 462 LK-KILQLKKGRQSSLY*LQEEISS 533
           L+ KIL+L+  RQS +Y  +E+ ++
Sbjct: 614 LEDKILELEADRQSVIYDKREKTTA 638


>At1g20060.1 68414.m02511 kinesin motor protein-related
          Length = 951

 Score = 27.5 bits (58), Expect = 9.4
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = +3

Query: 333 RLQPIRSFTLKVKRSKRALTSL--DSPSFANNAKKQLSAERQRKNLKK 470
           R++P+R+FT     +K    ++   +PS  NNAK+  + E  +K  KK
Sbjct: 82  RIKPLRTFTKVTTTTKSRPRNVWPQNPSKKNNAKENRNPEITKKVRKK 129


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,173,366
Number of Sequences: 28952
Number of extensions: 125917
Number of successful extensions: 395
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 379
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 394
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1555552968
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -