SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20018
         (688 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g61530.2 68418.m07721 small G protein family protein / RhoGAP...    36   0.033
At5g61530.1 68418.m07720 small G protein family protein / RhoGAP...    36   0.033
At5g22400.1 68418.m02613 rac GTPase activating protein, putative...    29   2.2  
At3g48030.1 68416.m05236 hypoxia-responsive family protein / zin...    29   2.2  
At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein...    27   8.8  

>At5g61530.2 68418.m07721 small G protein family protein / RhoGAP
           family protein contains Pfam domain, PF00620: RhoGAP
           domain
          Length = 367

 Score = 35.5 bits (78), Expect = 0.033
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQL 446
           +FGV ++ +V+R        +PL++    DYL   GL S ++++ E D+   QQL
Sbjct: 136 VFGVAIEITVQRQE--SSRPIPLILVKCADYLILTGLNSPNLFKAEGDRKLIQQL 188


>At5g61530.1 68418.m07720 small G protein family protein / RhoGAP
           family protein contains Pfam domain, PF00620: RhoGAP
           domain
          Length = 376

 Score = 35.5 bits (78), Expect = 0.033
 Identities = 18/55 (32%), Positives = 31/55 (56%)
 Frame = +3

Query: 282 IFGVPLQQSVERSRCHDDTGLPLVVRDSIDYLQAHGLKSKDIYRTEPDKIKFQQL 446
           +FGV ++ +V+R        +PL++    DYL   GL S ++++ E D+   QQL
Sbjct: 136 VFGVAIEITVQRQE--SSRPIPLILVKCADYLILTGLNSPNLFKAEGDRKLIQQL 188


>At5g22400.1 68418.m02613 rac GTPase activating protein, putative
           similar to rac GTPase activating protein 1 [Lotus
           japonicus] GI:3695059; contains Pfam profile PF00620:
           RhoGAP domain
          Length = 466

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 2/41 (4%)
 Frame = +2

Query: 437 STTEEAVHG--SRAYIPVSLGRSCRLAMLKAFISELPESIL 553
           ++ EEAV    +R +IP  +   C   ++KA+  ELP S+L
Sbjct: 207 NSEEEAVREQLNRGFIPERIDVHCLAGLIKAWFRELPTSVL 247


>At3g48030.1 68416.m05236 hypoxia-responsive family protein / zinc
           finger (C3HC4-type RING finger) family protein similar
           to RING-H2 finger protein RHX1a [Arabidopsis thaliana]
           GI:3790591; contains Pfam profiles PF00097: Zinc finger
           C3HC4 type (RING finger), PF04588: Hypoxia induced
           protein conserved region
          Length = 349

 Score = 29.5 bits (63), Expect = 2.2
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +1

Query: 295 HCNSLWSALVAMTTPVCRWSSETASITYRHTD 390
           HC   W  L   T P+CR S  T+++ Y H++
Sbjct: 233 HCIDTW-LLSNSTCPLCRRSLSTSNVCYNHSE 263


>At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein
           contains PF01422: NF-X1 type zinc finger
          Length = 912

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 8/11 (72%), Positives = 9/11 (81%)
 Frame = +1

Query: 631 HHKLPNCNHIC 663
           H KLPNC H+C
Sbjct: 703 HRKLPNCTHLC 713


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,268,448
Number of Sequences: 28952
Number of extensions: 223877
Number of successful extensions: 682
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 664
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 682
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1457719448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -