SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20013
         (724 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,...   143   9e-35
At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E...   100   1e-21
At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha ...    87   8e-18
At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha ...    87   8e-18
At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha ...    87   8e-18
At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha ...    87   8e-18
At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA) ide...    64   1e-10
At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,...    60   1e-09
At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-...    38   0.005
At4g18330.2 68417.m02719 eukaryotic translation initiation facto...    36   0.036
At4g18330.1 68417.m02718 eukaryotic translation initiation facto...    36   0.036
At4g11160.1 68417.m01808 translation initiation factor IF-2, mit...    35   0.063
At2g18720.1 68415.m02180 eukaryotic translation initiation facto...    35   0.063
At1g06220.2 68414.m00656 elongation factor Tu family protein sim...    34   0.083
At1g06220.1 68414.m00655 elongation factor Tu family protein sim...    34   0.083
At2g45030.1 68415.m05606 mitochondrial elongation factor, putati...    34   0.11 
At1g45332.1 68414.m05195 mitochondrial elongation factor, putati...    34   0.11 
At1g04170.1 68414.m00407 eukaryotic translation initiation facto...    34   0.11 
At1g76720.1 68414.m08929 eukaryotic translation initiation facto...    33   0.14 
At5g08650.1 68418.m01029 GTP-binding protein LepA, putative            33   0.25 
At2g29880.1 68415.m03628 hypothetical protein                          33   0.25 
At1g76825.1 68414.m08940 eukaryotic translation initiation facto...    32   0.33 
At1g76810.1 68414.m08938 eukaryotic translation initiation facto...    32   0.33 
At1g21160.1 68414.m02646 eukaryotic translation initiation facto...    32   0.33 
At5g37570.1 68418.m04526 pentatricopeptide (PPR) repeat-containi...    32   0.44 
At1g17220.1 68414.m02098 translation initiation factor IF-2, chl...    31   0.58 
At5g13650.2 68418.m01585 elongation factor family protein contai...    31   1.0  
At5g13650.1 68418.m01584 elongation factor family protein contai...    31   1.0  
At5g25230.1 68418.m02991 elongation factor Tu family protein tra...    30   1.8  
At4g16835.1 68417.m02541 pentatricopeptide (PPR) repeat-containi...    29   3.1  
At3g22980.1 68416.m02898 elongation factor Tu family protein sim...    29   3.1  
At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related conta...    29   4.1  
At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related conta...    29   4.1  
At1g62750.1 68414.m07082 elongation factor Tu family protein sim...    29   4.1  
At4g38410.1 68417.m05429 dehydrin, putative similar to dehydrin ...    28   5.5  
At3g56990.1 68416.m06344 glycine-rich protein conserved hypothet...    28   5.5  
At2g47860.2 68415.m05974 phototropic-responsive NPH3 family prot...    28   7.2  
At2g47860.1 68415.m05973 phototropic-responsive NPH3 family prot...    28   7.2  
At4g28070.1 68417.m04026 AFG1-like ATPase family protein contain...    27   9.5  
At1g63220.1 68414.m07146 C2 domain-containing protein similar to...    27   9.5  

>At1g18070.1 68414.m02236 EF-1-alpha-related GTP-binding protein,
           putative similar to EF-1-alpha-related GTP-binding
           protein gi|1009232|gb|AAA79032
          Length = 532

 Score =  143 bits (347), Expect = 9e-35
 Identities = 63/82 (76%), Positives = 75/82 (91%)
 Frame = +3

Query: 264 WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAV 443
           WY+++ +DTN+EER KGKTVEVGRA+FETE   FTILDAPGHKS+VPNMI GA+QAD+ V
Sbjct: 148 WYMAYIMDTNEEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGV 207

Query: 444 LVISARKGEFETGFDRGGQTRD 509
           LVISARKGEFETG++RGGQTR+
Sbjct: 208 LVISARKGEFETGYERGGQTRE 229



 Score = 82.6 bits (195), Expect = 2e-16
 Identities = 41/84 (48%), Positives = 58/84 (69%)
 Frame = +1

Query: 4   HEEELDTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQ 183
           H+E +   V N    ++    +K  K++   V +  +KK H+NVVFIGHVDAGKSTIGGQ
Sbjct: 62  HDEVMLHPVHNPAKAKEKAAQEKAAKEEAEDVAEA-NKKRHLNVVFIGHVDAGKSTIGGQ 120

Query: 184 IMSLTGMVDKRTLEKYEREAREKS 255
           I+ L+G VD R ++KYE+EA++KS
Sbjct: 121 ILFLSGQVDDRQIQKYEKEAKDKS 144



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 26/44 (59%), Positives = 35/44 (79%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           H  LAKT GV  L+ +VNKMDDPTVNW ++RY+E  +K++P+LK
Sbjct: 230 HVQLAKTLGVSKLIVVVNKMDDPTVNWSKERYDEIEQKMVPFLK 273



 Score = 29.5 bits (63), Expect = 2.4
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = +1

Query: 646 GFNTAKDLSFLPVSGQTGQ 702
           G+NT KD+ FLP+SG  G+
Sbjct: 276 GYNTKKDVVFLPISGLMGK 294


>At5g10630.1 68418.m01231 elongation factor 1-alpha, putative /
           EF-1-alpha, putative contains similarity to
           SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha)
           [Aeropyrum pernix]
          Length = 667

 Score =  100 bits (239), Expect = 1e-21
 Identities = 46/80 (57%), Positives = 58/80 (72%), Gaps = 1/80 (1%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +WALD + EER++G T+ V  AYF +++ H  +LD+PGHK FVPNMI GA QAD A+LVI
Sbjct: 289 AWALDESAEERERGITMTVAVAYFNSKRHHVVLLDSPGHKDFVPNMIAGATQADAAILVI 348

Query: 453 SARKGEFETGFDR-GGQTRD 509
            A  G FE GFD   GQTR+
Sbjct: 349 DASVGAFEAGFDNLKGQTRE 368



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 28/102 (27%), Positives = 53/102 (51%), Gaps = 5/102 (4%)
 Frame = +1

Query: 28  VGNTNPNEDGELT--KKIPKKKPPR---VEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMS 192
           +G T  + D ++   K   K KP     ++        +N+  +GHVD+GKST+ G+++ 
Sbjct: 202 IGETENSSDIKIRGPKSQSKHKPEEWMLLDKESDALSQLNLAIVGHVDSGKSTLSGRLLH 261

Query: 193 LTGMVDKRTLEKYEREAREKSENHGTYHGHWTQIKKNETKAK 318
           L G + ++ + KYE+EA  K +  G++   W   +  E + +
Sbjct: 262 LLGRISQKQMHKYEKEA--KLQGKGSFAYAWALDESAEERER 301


>At5g60390.1 68418.m07574 elongation factor 1-alpha / EF-1-alpha
           identical to SWISS-PROT:P13905 elongation factor 1-alpha
           (EF-1-alpha) [Arabidopsis thaliana]
          Length = 449

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK 179


>At1g07940.1 68414.m00863 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK 179


>At1g07930.1 68414.m00862 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK 179


>At1g07920.1 68414.m00861 elongation factor 1-alpha / EF-1-alpha
           identical to GB:CAA34456 from [Arabidopsis thaliana]
           (Plant Mol. Biol. 14 (1), 107-110 (1990))
          Length = 449

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 37/79 (46%), Positives = 54/79 (68%)
 Frame = +3

Query: 273 SWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           +W LD  + ER++G T+++    FET K + T++DAPGH+ F+ NMI G +QAD AVL+I
Sbjct: 57  AWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLII 116

Query: 453 SARKGEFETGFDRGGQTRD 509
            +  G FE G  + GQTR+
Sbjct: 117 DSTTGGFEAGISKDGQTRE 135



 Score = 57.6 bits (133), Expect = 8e-09
 Identities = 24/53 (45%), Positives = 37/53 (69%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSENHGTY 273
           +K H+N+V IGHVD+GKST  G ++   G +DKR +E++E+EA E ++    Y
Sbjct: 4   EKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKY 56



 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/44 (43%), Positives = 28/44 (63%)
 Frame = +2

Query: 509 HAMLAKTAGVKHLVALVNKMDDPTVNWDEKRYNECREKILPYLK 640
           HA+LA T GVK ++   NKMD  T  + + RY+E  +++  YLK
Sbjct: 136 HALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLK 179


>At4g20360.1 68417.m02971 elongation factor Tu / EF-Tu (TUFA)
           identical to SWISS-PROT:P17745 elongation factor Tu,
           chloroplast precursor (EF-Tu) [Arabidopsis thaliana]
          Length = 476

 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 28/62 (45%), Positives = 38/62 (61%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EER +G T+      +ETE +H+  +D PGH  +V NMI GAAQ D A+LV+S  
Sbjct: 117 IDAAPEERARGITINTATVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGA 176

Query: 462 KG 467
            G
Sbjct: 177 DG 178



 Score = 35.9 bits (79), Expect = 0.027
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = +1

Query: 115 KKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYE 234
           KK HVN+  IGHVD GK+T+   +      +     +KY+
Sbjct: 76  KKPHVNIGTIGHVDHGKTTLTAALTMALASIGSSVAKKYD 115


>At4g02930.1 68417.m00399 elongation factor Tu, putative / EF-Tu,
           putative similar to mitochondrial elongation factor Tu
           [Arabidopsis thaliana] gi|1149571|emb|CAA61511
          Length = 454

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 26/62 (41%), Positives = 37/62 (59%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +G T+      +ET K+H+  +D PGH  +V NMI GAAQ D  +LV+S  
Sbjct: 105 IDKAPEEKKRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSGP 164

Query: 462 KG 467
            G
Sbjct: 165 DG 166



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 14/23 (60%), Positives = 16/23 (69%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQI 186
           K HVNV  IGHVD GK+T+   I
Sbjct: 65  KPHVNVGTIGHVDHGKTTLTAAI 87


>At5g39900.1 68418.m04839 GTP-binding protein LepA, putative
           GTP-binding protein GUF1 - Saccharomyces cerevisiae,
           PIR:S50374
          Length = 661

 Score = 38.3 bits (85), Expect = 0.005
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 6/58 (10%)
 Frame = +1

Query: 85  KPPRVEDTRSKKEHV-NVVFIGHVDAGKSTIGGQIMSLTGMVDK-----RTLEKYERE 240
           K P ++ T+   E + N   I H+D GKST+  ++M LTG + K     + L+K +RE
Sbjct: 52  KEPTIDLTKFPSEKIRNFSIIAHIDHGKSTLADRLMELTGTIKKGHGQPQYLDKLQRE 109


>At4g18330.2 68417.m02719 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 471

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 348 TEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           T ++H + +D PGH   +  M+ GAA  D A+L+I+A +
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANE 162



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           +LTK    K  P   +  S++  +N+  IGHV  GKSTI   I  +  +  K  LE+
Sbjct: 17  DLTKLDVTKLHPLFPEVISRQATINIGTIGHVAHGKSTIVKAISGVQTVRFKNELER 73


>At4g18330.1 68417.m02718 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to SP|Q09130 Eukaryotic translation
           initiation factor 2 gamma subunit (eIF-2- gamma)
           {Schizosaccharomyces pombe}; contains Pfam profile
           PF00009: Elongation factor Tu GTP binding domain;
           isoform predicted to contain a TG non-consensus acceptor
           splice site.
          Length = 284

 Score = 35.5 bits (78), Expect = 0.036
 Identities = 15/39 (38%), Positives = 25/39 (64%)
 Frame = +3

Query: 348 TEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           T ++H + +D PGH   +  M+ GAA  D A+L+I+A +
Sbjct: 124 TLRRHVSCVDCPGHDILMATMLNGAAIVDGALLLIAANE 162



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 20/57 (35%), Positives = 29/57 (50%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           +LTK    K  P   +  S++  +N+  IGHV  GKSTI   I  +  +  K  LE+
Sbjct: 17  DLTKLDVTKLHPLFPEVISRQATINIGTIGHVAHGKSTIVKAISGVQTVRFKNELER 73


>At4g11160.1 68417.m01808 translation initiation factor IF-2,
           mitochondrial, putative similar to SP|P46198|IF2M_BOVIN
           Translation initiation factor IF-2, mitochondrial
           precursor (IF-2Mt) (IF-2(Mt)) {Bos taurus}
          Length = 743

 Score = 34.7 bits (76), Expect = 0.063
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +3

Query: 366 TILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           T LD PGH +F      GAA  D+ VLV++A  G
Sbjct: 271 TFLDTPGHAAFSEMRARGAAVTDIVVLVVAADDG 304


>At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative 
          Length = 465

 Score = 34.7 bits (76), Expect = 0.063
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+A +
Sbjct: 119 RHVSFVDCPGHDILMATMLNGAAIMDGALLIIAANE 154



 Score = 27.5 bits (58), Expect = 9.5
 Identities = 17/57 (29%), Positives = 29/57 (50%)
 Frame = +1

Query: 58  ELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           +L+K    +  P   +  S++  +N+  IGHV  GKSTI   +  +  +  K  LE+
Sbjct: 11  DLSKLDVAQLHPLSPEVISRQATINIGTIGHVAHGKSTIVKAVSGVHTVKFKSELER 67


>At1g06220.2 68414.m00656 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 34.3 bits (75), Expect = 0.083
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = +3

Query: 285 DTNQEERDKG---KTVEVGRAYFETEKKHF--TILDAPGHKSFVPNMIGGAAQADLAVLV 449
           DT  +E+++    K V +     ++  K +   I+D PGH +F   M      AD AVL+
Sbjct: 180 DTRVDEQERNISIKAVPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLI 239

Query: 450 ISARKG 467
           + A +G
Sbjct: 240 VDAAEG 245


>At1g06220.1 68414.m00655 elongation factor Tu family protein
           similar to Cryptosporidium parvum elongation factor-2
           GB:U21667 GI:706974 from [Cryptosporidium parvum]
          Length = 987

 Score = 34.3 bits (75), Expect = 0.083
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 5/66 (7%)
 Frame = +3

Query: 285 DTNQEERDKG---KTVEVGRAYFETEKKHF--TILDAPGHKSFVPNMIGGAAQADLAVLV 449
           DT  +E+++    K V +     ++  K +   I+D PGH +F   M      AD AVL+
Sbjct: 180 DTRVDEQERNISIKAVPMSLVLEDSRSKSYLCNIMDTPGHVNFSDEMTASLRLADGAVLI 239

Query: 450 ISARKG 467
           + A +G
Sbjct: 240 VDAAEG 245


>At2g45030.1 68415.m05606 mitochondrial elongation factor, putative
           similar to SP|P25039 Elongation factor G 1,
           mitochondrial precursor (mEF-G-1) {Saccharomyces
           cerevisiae}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03764: Elongation factor
           G domain IV, PF00679: Elongation factor G C-terminus
          Length = 754

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+   ER+KG T++    Y   +     I+D PGH  F   +       D A+LV+ + 
Sbjct: 108 MDSMDLEREKGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSV 167

Query: 462 KG 467
            G
Sbjct: 168 GG 169



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/51 (21%), Positives = 28/51 (54%)
 Frame = +1

Query: 55  GELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMV 207
           G   + +  +K P  +++  K  ++ +    H+D+GK+T+  +++  TG +
Sbjct: 44  GTAARAVKDEKEPWWKESMDKLRNIGIS--AHIDSGKTTLTERVLFYTGRI 92


>At1g45332.1 68414.m05195 mitochondrial elongation factor, putative
           similar to mitochondrial elongation factor GI:3917 from
           [Saccharomyces cerevisiae]
          Length = 754

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 18/62 (29%), Positives = 29/62 (46%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+   ER+KG T++    Y   +     I+D PGH  F   +       D A+LV+ + 
Sbjct: 108 MDSMDLEREKGITIQSAATYCTWKDYKVNIIDTPGHVDFTIEVERALRVLDGAILVLCSV 167

Query: 462 KG 467
            G
Sbjct: 168 GG 169


>At1g04170.1 68414.m00407 eukaryotic translation initiation factor 2
           subunit 3, putative / eIF2S3, putative / eIF-2-gamma,
           putative similar to gb|U37354 from S. pombe. ESTs
           gb|T41979, gb|N37284 and gb|N37529 come from this gene
          Length = 465

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 14/36 (38%), Positives = 23/36 (63%)
 Frame = +3

Query: 357 KHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARK 464
           +H + +D PGH   +  M+ GAA  D A+L+I+A +
Sbjct: 121 RHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANE 156



 Score = 27.5 bits (58), Expect = 9.5
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +1

Query: 91  PRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           P   +  S++  +N+  IGHV  GKST+   I  +  +  K  LE+
Sbjct: 22  PLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRFKNELER 67


>At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1201

 Score = 33.5 bits (73), Expect = 0.14
 Identities = 13/33 (39%), Positives = 21/33 (63%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           ++D PGH+SF      G++  DLA+LV+  + G
Sbjct: 705 VIDTPGHESFTNLRSRGSSLCDLAILVVDIKHG 737


>At5g08650.1 68418.m01029 GTP-binding protein LepA, putative
          Length = 681

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 12/33 (36%), Positives = 21/33 (63%)
 Frame = +1

Query: 130 NVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEK 228
           N   I H+D GKST+  +++ +TG V  R +++
Sbjct: 88  NFSIIAHIDHGKSTLADKLLQVTGTVQNRDMKE 120



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 4/66 (6%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRA----YFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLV 449
           LD    ER++G T+++  A     +E       ++D PGH  F   +    A  + A+LV
Sbjct: 123 LDNMDLERERGITIKLQAARMRYVYEDTPFCLNLIDTPGHVDFSYEVSRSLAACEGALLV 182

Query: 450 ISARKG 467
           + A +G
Sbjct: 183 VDASQG 188


>At2g29880.1 68415.m03628 hypothetical protein
          Length = 308

 Score = 32.7 bits (71), Expect = 0.25
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 5/103 (4%)
 Frame = +1

Query: 7   EEELDTQVG-NTNPNE--DGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIG 177
           EEE D Q G N N  E  D E+ + +PK+K P  + +++ +       I H ++ +  + 
Sbjct: 166 EEEDDLQAGDNVNHMEINDDEVNETLPKEKLPTRKRSKTNRNGDRSDSINHGESSEKVLS 225

Query: 178 GQIMSLTGMVD--KRTLEKYEREAREKSENHGTYHGHWTQIKK 300
             I   T +++  ++  E+++RE  E  E     +  W  IK+
Sbjct: 226 EMIGVGTNIINLIQQREERHQREV-EFRETEKKKNNVWDAIKE 267


>At1g76825.1 68414.m08940 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profile PF00009: Elongation
           factor Tu GTP binding domain
          Length = 630

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           ++D PGH+SF      G++  DLA+LV+    G
Sbjct: 113 VIDTPGHESFTNLRSRGSSLCDLAILVVDITHG 145


>At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to IF2
           protein [Drosophila melanogaster] GI:7108770; contains
           Pfam profile PF03144: Elongation factor Tu domain 2
          Length = 1294

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           ++D PGH+SF      G++  DLA+LV+    G
Sbjct: 772 VIDTPGHESFTNLRSRGSSLCDLAILVVDIMHG 804


>At1g21160.1 68414.m02646 eukaryotic translation initiation factor 2
           family protein / eIF-2 family protein similar to
           SP|O60841 Translation initiation factor IF-2 {Homo
           sapiens}; contains Pfam profiles PF00009: Elongation
           factor Tu GTP binding domain, PF03144: Elongation factor
           Tu domain 2
          Length = 1088

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +3

Query: 369 ILDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           ++D PGH+SF      G+   DLA+LV+   +G
Sbjct: 560 VIDTPGHESFTNLRSRGSNLCDLAILVVDIMRG 592


>At5g37570.1 68418.m04526 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 550

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 13/35 (37%), Positives = 22/35 (62%)
 Frame = +3

Query: 309 KGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMI 413
           + + VE G  YFE  +K ++IL +P H S + N++
Sbjct: 418 QSRLVEEGLRYFELMRKKYSILASPDHYSCIVNLL 452


>At1g17220.1 68414.m02098 translation initiation factor IF-2,
           chloroplast, putative similar to SP|P57997|IF2C_PHAVU
           Translation initiation factor IF-2, chloroplast
           precursor (PvIF2cp) {Phaseolus vulgaris}
          Length = 1026

 Score = 31.5 bits (68), Expect = 0.58
 Identities = 13/32 (40%), Positives = 20/32 (62%)
 Frame = +3

Query: 372 LDAPGHKSFVPNMIGGAAQADLAVLVISARKG 467
           LD PGH++F      GA   D+A++V++A  G
Sbjct: 557 LDTPGHEAFGAMRARGARVTDIAIIVVAADDG 588


>At5g13650.2 68418.m01585 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 676

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 16/62 (25%), Positives = 28/62 (45%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+N  ER++G T+         +     I+D PGH  F   +       D  +LV+ + 
Sbjct: 121 MDSNDLERERGITILSKNTSITYKNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSV 180

Query: 462 KG 467
           +G
Sbjct: 181 EG 182


>At5g13650.1 68418.m01584 elongation factor family protein contains
           Pfam profiles: PF00009 elongation factor Tu GTP binding
           domain,PF00679 elongation factor G C-terminus,  PF03144
           elongation factor Tu domain 2
          Length = 675

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 16/62 (25%), Positives = 28/62 (45%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D+N  ER++G T+         +     I+D PGH  F   +       D  +LV+ + 
Sbjct: 120 MDSNDLERERGITILSKNTSITYKNTKVNIIDTPGHSDFGGEVERVLNMVDGVLLVVDSV 179

Query: 462 KG 467
           +G
Sbjct: 180 EG 181


>At5g25230.1 68418.m02991 elongation factor Tu family protein
           translation Elongation Factor 2, Schizosaccharomyces
           pombe, PIR:T39902
          Length = 973

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 5/66 (7%)
 Frame = +3

Query: 285 DTNQEERDKG---KTVEVGRAYFETEKKHF--TILDAPGHKSFVPNMIGGAAQADLAVLV 449
           DT  +E+++    K V +     ++  K +   I+D PG+ +F   M      AD AV +
Sbjct: 166 DTRVDEQERNISIKAVPMSLVLEDSRSKSYLCNIMDTPGNVNFSDEMTASLRLADGAVFI 225

Query: 450 ISARKG 467
           + A +G
Sbjct: 226 VDAAQG 231


>At4g16835.1 68417.m02541 pentatricopeptide (PPR) repeat-containing
           protein contains INTERPRO:IPR002885 PPR repeats
          Length = 575

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 12/44 (27%), Positives = 26/44 (59%)
 Frame = +3

Query: 321 VEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVI 452
           V +G AYFE+  + + +   P H + + +++G A + + A+ +I
Sbjct: 315 VNIGMAYFESMVRDYKVEPQPDHYTCMVDLLGRAGKLEEALKLI 358


>At3g22980.1 68416.m02898 elongation factor Tu family protein
           similar to eukaryotic translation elongation factor 2
           GB:NP_001952 [Homo sapiens]
          Length = 1015

 Score = 29.1 bits (62), Expect = 3.1
 Identities = 14/62 (22%), Positives = 31/62 (50%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISAR 461
           +D   EE+ +  T++      + +     ++D+PGH  F   +   A  +D A++++ A 
Sbjct: 49  MDYLDEEQRRAITMKSSSISLKYKDYSLNLIDSPGHMDFCSEVSTAARLSDGALVLVDAV 108

Query: 462 KG 467
           +G
Sbjct: 109 EG 110


>At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related contains
           weak similarity to 2-phosphoglycerate kinase (GI:467751)
           [Methanothermus fervidus]
          Length = 698

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +1

Query: 109 RSKKEHVNVVFIGHVDAGKSTIG---GQIMSLTGMVDKRTLEKYEREAREKSEN----HG 267
           R +KE V V+  G    GKST+    G  + +T +V   ++    R   ++ +N      
Sbjct: 134 RERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWAS 193

Query: 268 TYHG--HWTQIKKNETKAKQ 321
           TYH   +   +   E+KAK+
Sbjct: 194 TYHAGEYLDPVAVAESKAKR 213


>At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related contains
           weak similarity to 2-phosphoglycerate kinase (GI:467751)
           [Methanothermus fervidus]
          Length = 717

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 9/80 (11%)
 Frame = +1

Query: 109 RSKKEHVNVVFIGHVDAGKSTIG---GQIMSLTGMVDKRTLEKYEREAREKSEN----HG 267
           R +KE V V+  G    GKST+    G  + +T +V   ++    R   ++ +N      
Sbjct: 153 RERKESVTVLLCGTSGCGKSTLSALLGSRLGITTVVSTDSIRHMMRSFADEKQNPLLWAS 212

Query: 268 TYHG--HWTQIKKNETKAKQ 321
           TYH   +   +   E+KAK+
Sbjct: 213 TYHAGEYLDPVAVAESKAKR 232


>At1g62750.1 68414.m07082 elongation factor Tu family protein
           similar to elongation factor G SP:P34811 [Glycine max
           (Soybean)]
          Length = 783

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 11/28 (39%), Positives = 19/28 (67%)
 Frame = +1

Query: 118 KEHVNVVFIGHVDAGKSTIGGQIMSLTG 201
           K++ N+  + H+DAGK+T   +I+  TG
Sbjct: 94  KDYRNIGIMAHIDAGKTTTTERILYYTG 121



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/39 (28%), Positives = 20/39 (51%)
 Frame = +3

Query: 282 LDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSF 398
           +D  ++E+++G T+         +K    I+D PGH  F
Sbjct: 136 MDWMEQEQERGITITSAATTTFWDKHRINIIDTPGHVDF 174


>At4g38410.1 68417.m05429 dehydrin, putative similar to dehydrin
           ERD10 (Low-temperature-induced protein LTI45)
           [Arabidopsis thaliana] SWISS-PROT:P42759
          Length = 163

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 27/102 (26%), Positives = 40/102 (39%), Gaps = 5/102 (4%)
 Frame = +1

Query: 19  DTQVGNTNPNEDGELTKKIPKKKPPRVEDTRSKKEHVNVVFIGHVDAGKSTIGGQIMSLT 198
           D+   +    E+GE  +K  KKK   V + + + E      IGH D  +     +I    
Sbjct: 62  DSSSSDEEAGENGEKKEKKKKKKKNEVAEDQCETEEKIPAGIGHEDGKEKGFMEKIKDKL 121

Query: 199 --GMVDKRTLEKYEREAREK---SENHGTYHGHWTQIKKNET 309
             G   K   E +  +A+EK    +      GH    KK ET
Sbjct: 122 PGGHNGKPEAEPHNDKAKEKGFMEKIKEKLPGHTNDEKKKET 163


>At3g56990.1 68416.m06344 glycine-rich protein conserved
           hypothetical protein SPCC330.09 - Schizosaccharomyces
           pombe, PIR:T41319
          Length = 711

 Score = 28.3 bits (60), Expect = 5.5
 Identities = 12/19 (63%), Positives = 14/19 (73%)
 Frame = +1

Query: 49  EDGELTKKIPKKKPPRVED 105
           EDGE TKK+ KKK P + D
Sbjct: 478 EDGEATKKVLKKKKPILTD 496


>At2g47860.2 68415.m05974 phototropic-responsive NPH3 family protein
           contains NPH3 family domain, Pfam:PF03000
          Length = 517

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +3

Query: 66  KKDSKEKTTTSRRYTKQKRTC 128
           KK ++EKT + RR+  QKR C
Sbjct: 493 KKHTEEKTNSERRFMFQKRRC 513


>At2g47860.1 68415.m05973 phototropic-responsive NPH3 family protein
           contains NPH3 family domain, Pfam:PF03000
          Length = 635

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +3

Query: 66  KKDSKEKTTTSRRYTKQKRTC 128
           KK ++EKT + RR+  QKR C
Sbjct: 611 KKHTEEKTNSERRFMFQKRRC 631


>At4g28070.1 68417.m04026 AFG1-like ATPase family protein contains
           Pfam profile: PF03969 AFG1-like ATPase
          Length = 464

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = -3

Query: 467 AFTCRNDQYSEVSLSSPTNHVWNKTFVS 384
           A  CR D+YS  + S+ +N  WNK FVS
Sbjct: 100 ADACRLDRYSASAKSTRSNWFWNK-FVS 126


>At1g63220.1 68414.m07146 C2 domain-containing protein similar to
           phloem protein RPP16 [Oryza sativa (japonica
           cultivar-group)] GI:21998839; contains Pfam profile
           PF00168: C2 domain
          Length = 147

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%)
 Frame = -3

Query: 461 TCRN-DQYSEVSLSSPTNHVWNKTF---VSRGIKNCKMLLFSLKISSSN 327
           TCR  DQ S V+    T   WN+TF   VS G    K  +F   + + +
Sbjct: 32  TCRTQDQKSNVAEGMGTTPEWNETFIFTVSEGTTELKAKIFDKDVGTED 80


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,008,715
Number of Sequences: 28952
Number of extensions: 294123
Number of successful extensions: 1159
Number of sequences better than 10.0: 40
Number of HSP's better than 10.0 without gapping: 1098
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1159
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1575119672
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -