SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20007
         (719 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondri...    91   9e-19
At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial...    91   9e-19
At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondri...    87   8e-18
At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondri...    87   8e-18
At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial...    78   7e-15
At5g56450.1 68418.m07046 mitochondrial substrate carrier family ...    74   1e-13
At4g01100.1 68417.m00148 mitochondrial substrate carrier family ...    48   8e-06
At4g26180.1 68417.m03768 mitochondrial substrate carrier family ...    47   1e-05
At1g78180.1 68414.m09110 mitochondrial substrate carrier family ...    46   3e-05
At3g51870.1 68416.m05688 mitochondrial substrate carrier family ...    45   4e-05
At1g14560.1 68414.m01731 mitochondrial substrate carrier family ...    45   4e-05
At5g51050.1 68418.m06328 mitochondrial substrate carrier family ...    44   1e-04
At5g01500.1 68418.m00064 mitochondrial substrate carrier family ...    43   2e-04
At3g55640.1 68416.m06182 mitochondrial substrate carrier family ...    43   2e-04
At5g61810.1 68418.m07756 mitochondrial substrate carrier family ...    42   3e-04
At5g07320.1 68418.m00836 mitochondrial substrate carrier family ...    41   7e-04
At5g64970.1 68418.m08172 mitochondrial substrate carrier family ...    40   0.002
At3g53940.1 68416.m05959 mitochondrial substrate carrier family ...    39   0.003
At3g48850.1 68416.m05335 mitochondrial phosphate transporter, pu...    38   0.007
At2g37890.1 68415.m04651 mitochondrial substrate carrier family ...    38   0.007
At1g14140.1 68414.m01671 mitochondrial substrate carrier family ...    37   0.015
At1g25380.1 68414.m03150 mitochondrial substrate carrier family ...    36   0.020
At2g47490.1 68415.m05928 mitochondrial substrate carrier family ...    34   0.11 
At4g39460.1 68417.m05583 mitochondrial substrate carrier family ...    33   0.19 
At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit...    32   0.33 
At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier, p...    32   0.44 
At4g32400.1 68417.m04613 mitochondrial substrate carrier family ...    32   0.44 
At2g46610.2 68415.m05813 arginine/serine-rich splicing factor, p...    32   0.44 
At2g46610.1 68415.m05814 arginine/serine-rich splicing factor, p...    32   0.44 
At4g24570.1 68417.m03521 mitochondrial substrate carrier family ...    31   0.77 
At4g03115.1 68417.m00424 mitochondrial substrate carrier family ...    31   0.77 
At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36) id...    31   0.77 
At3g21390.1 68416.m02700 mitochondrial substrate carrier family ...    31   1.0  
At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15) ...    31   1.0  
At3g20240.1 68416.m02564 mitochondrial substrate carrier family ...    30   1.8  
At4g15210.1 68417.m02330 beta-amylase (BMY1) / 1,4-alpha-D-gluca...    29   2.3  
At1g74240.1 68414.m08598 mitochondrial substrate carrier family ...    29   2.3  
At5g66380.1 68418.m08370 mitochondrial substrate carrier family ...    29   4.1  
At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to ...    29   4.1  
At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to ...    29   4.1  
At5g15640.1 68418.m01830 mitochondrial substrate carrier family ...    29   4.1  
At2g17270.1 68415.m01995 mitochondrial substrate carrier family ...    29   4.1  
At4g08350.1 68417.m01380 KOW domain-containing transcription fac...    28   5.4  
At2g43770.1 68415.m05441 transducin family protein / WD-40 repea...    28   5.4  
At2g35800.1 68415.m04396 mitochondrial substrate carrier family ...    28   5.4  
At1g72820.1 68414.m08419 mitochondrial substrate carrier family ...    28   7.2  
At5g13590.1 68418.m01572 expressed protein                             27   9.5  
At5g01340.1 68418.m00047 mitochondrial substrate carrier family ...    27   9.5  
At2g46320.1 68415.m05761 mitochondrial substrate carrier family ...    27   9.5  

>At5g13490.1 68418.m01556 ADP, ATP carrier protein 2, mitochondrial
           / ADP/ATP translocase 2 / adenine nucleotide
           translocator 2 (ANT2) identical to SWISS-PROT:P40941
           ADP,ATP carrier protein 2, mitochondrial precursor
           (Adenine nucleotide translocator 2) [Arabidopsis
           thaliana]
          Length = 385

 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 50/93 (53%), Positives = 60/93 (64%), Gaps = 3/93 (3%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXX 418
           +G GSL  WRGN ANVIRYFPTQALNFAFKD +K++F    D K  +W++F         
Sbjct: 142 EGIGSL--WRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKD-KDGYWKWFAGNLASGGA 198

Query: 419 XXXTSLCFVYPLDFARTRLAAD---VGKGDGQR 508
              +SL FVY LD+ARTRLA D     KG G+R
Sbjct: 199 AGASSLLFVYSLDYARTRLANDSKSAKKGGGER 231



 Score = 63.7 bits (148), Expect = 1e-10
 Identities = 34/61 (55%), Positives = 43/61 (70%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           FA DF+ GG+SAAVSKTA APIERVKLL+Q Q  + K     + YKGI D F R  +++G
Sbjct: 84  FAIDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEMLKAGRLTEPYKGIRDCFGRTIRDEG 143

Query: 252 L 254
           +
Sbjct: 144 I 144



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 14/24 (58%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+GL +   K  KSDG+ GLYRGF
Sbjct: 233 FNGLVDVYKKTLKSDGIAGLYRGF 256



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 11/21 (52%), Positives = 15/21 (71%)
 Frame = +3

Query: 594 ASIIIYRASYFGFYDTARGML 656
           A II+YR  YFG YD+ + +L
Sbjct: 261 AGIIVYRGLYFGLYDSVKPVL 281


>At4g28390.1 68417.m04063 ADP, ATP carrier protein, mitochondrial,
           putative / ADP/ATP translocase, putative / adenine
           nucleotide translocator, putative similar to
           mitochondrial ADP,ATP carrier protein SP:P12857 from
           [Zea mays]
          Length = 379

 Score = 90.6 bits (215), Expect = 9e-19
 Identities = 47/89 (52%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G L+ WRGN ANVIRYFPTQALNFAFKD +K++F     +K  +W++F            
Sbjct: 138 GMLALWRGNTANVIRYFPTQALNFAFKDYFKRLF-NFKKEKDGYWKWFAGNLASGGAAGA 196

Query: 428 TSLCFVYPLDFARTRLAAD--VGKGDGQR 508
           +SL FVY LD+ARTRLA D    K  GQR
Sbjct: 197 SSLLFVYSLDYARTRLANDAKAAKKGGQR 225



 Score = 66.1 bits (154), Expect = 2e-11
 Identities = 35/61 (57%), Positives = 42/61 (68%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F  DFL GG+SAAVSKTA APIERVKLL+Q Q  + K     + YKGI D F R  K++G
Sbjct: 79  FLIDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGISDCFARTVKDEG 138

Query: 252 L 254
           +
Sbjct: 139 M 139



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F+G+ +   K   SDG++GLYRGF
Sbjct: 227 FNGMVDVYKKTIASDGIVGLYRGF 250


>At3g08580.2 68416.m00996 ADP, ATP carrier protein 1, mitochondrial
           / ADP/ATP translocase 1 / adenine nucleotide
           translocator 1 (ANT1) identical to SWISS-PROT:P31167
           ADP,ATP carrier protein 1 (Adenine nucleotide
           translocator 1) [Arabidopsis thaliana]
          Length = 381

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 49/93 (52%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXX 418
           +G GSL  WRGN ANVIRYFPTQALNFAFKD +K++F    D +  +W++F         
Sbjct: 138 EGFGSL--WRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKD-RDGYWKWFAGNLASGGA 194

Query: 419 XXXTSLCFVYPLDFARTRLAAD---VGKGDGQR 508
              +SL FVY LD+ARTRLA D     KG G R
Sbjct: 195 AGASSLLFVYSLDYARTRLANDAKAAKKGGGGR 227



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           FA DFL GG+SAAVSKTA APIERVKLL+Q Q  + K     + YKGI D F R  K++G
Sbjct: 80  FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEG 139



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GL +   K  K+DG+ GLYRGF
Sbjct: 229 FDGLVDVYRKTLKTDGIAGLYRGF 252



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGML 656
           II+YR  YFG YD+ + +L
Sbjct: 259 IIVYRGLYFGLYDSVKPVL 277


>At3g08580.1 68416.m00995 ADP, ATP carrier protein 1, mitochondrial
           / ADP/ATP translocase 1 / adenine nucleotide
           translocator 1 (ANT1) identical to SWISS-PROT:P31167
           ADP,ATP carrier protein 1 (Adenine nucleotide
           translocator 1) [Arabidopsis thaliana]
          Length = 381

 Score = 87.4 bits (207), Expect = 8e-18
 Identities = 49/93 (52%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXX 418
           +G GSL  WRGN ANVIRYFPTQALNFAFKD +K++F    D +  +W++F         
Sbjct: 138 EGFGSL--WRGNTANVIRYFPTQALNFAFKDYFKRLFNFKKD-RDGYWKWFAGNLASGGA 194

Query: 419 XXXTSLCFVYPLDFARTRLAAD---VGKGDGQR 508
              +SL FVY LD+ARTRLA D     KG G R
Sbjct: 195 AGASSLLFVYSLDYARTRLANDAKAAKKGGGGR 227



 Score = 65.7 bits (153), Expect = 3e-11
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 1/60 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           FA DFL GG+SAAVSKTA APIERVKLL+Q Q  + K     + YKGI D F R  K++G
Sbjct: 80  FALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEG 139



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 13/24 (54%), Positives = 16/24 (66%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           F GL +   K  K+DG+ GLYRGF
Sbjct: 229 FDGLVDVYRKTLKTDGIAGLYRGF 252



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = +3

Query: 600 IIIYRASYFGFYDTARGML 656
           II+YR  YFG YD+ + +L
Sbjct: 259 IIVYRGLYFGLYDSVKPVL 277


>At5g17400.1 68418.m02041 ADP, ATP carrier protein, mitochondrial,
           putative / ADP/ATP translocase, putative / adenine
           nucleotide translocator, putative similar to
           SWISS-PROT:Q09188 ADP,ATP carrier protein (ADP/ATP
           translocase) [Schizosaccharomyces pombe]; contains Pfam
           profile: PF00153 mitochondrial carrier protein
          Length = 306

 Score = 77.8 bits (183), Expect = 7e-15
 Identities = 40/79 (50%), Positives = 49/79 (62%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G LSFWRGN ANVIRYFPTQA NFAFK  +K + LG   +K  + ++F            
Sbjct: 69  GVLSFWRGNQANVIRYFPTQASNFAFKGYFKNL-LGCSKEKDGYLKWFAGNVASGSAAGA 127

Query: 428 TSLCFVYPLDFARTRLAAD 484
           T+  F+Y LD+ARTRL  D
Sbjct: 128 TTSLFLYHLDYARTRLGTD 146



 Score = 53.2 bits (122), Expect = 2e-07
 Identities = 29/61 (47%), Positives = 41/61 (67%), Gaps = 1/61 (1%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRYKGIVDAFVRIPKEQG 251
           F+ DF+ GG +A V+K+A APIERVKLLLQ Q  + K     + Y G+ + F RI +E+G
Sbjct: 10  FSADFVMGGAAAIVAKSAAAPIERVKLLLQNQGEMIKTGHLIRPYTGLGNCFTRIYREEG 69

Query: 252 L 254
           +
Sbjct: 70  V 70



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 9/23 (39%), Positives = 19/23 (82%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           ++GLGNC ++I++ +G++  +RG
Sbjct: 54  YTGLGNCFTRIYREEGVLSFWRG 76



 Score = 31.1 bits (67), Expect = 0.77
 Identities = 13/25 (52%), Positives = 16/25 (64%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           F G+ +   K   SDG+ GLYRGFG
Sbjct: 158 FKGMIDVYRKTLSSDGIKGLYRGFG 182


>At5g56450.1 68418.m07046 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 330

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 34/87 (39%), Positives = 50/87 (57%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G LS WRGN ++V+RY+P+ ALNF+ KD Y+ +      ++   +               
Sbjct: 94  GVLSLWRGNGSSVLRYYPSVALNFSLKDLYRSILRNSSSQENHIFSGALANFMAGSAAGC 153

Query: 428 TSLCFVYPLDFARTRLAADVGKGDGQR 508
           T+L  VYPLD A TRLAAD+GK + ++
Sbjct: 154 TALIVVYPLDIAHTRLAADIGKPEARQ 180



 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 29/66 (43%), Positives = 37/66 (56%), Gaps = 6/66 (9%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQ------RYKGIVDAFVRI 236
           F KD LAG +   V  T VAPIER KLLLQ Q  +  I  D+      R+KG+ D   R 
Sbjct: 30  FQKDLLAGAVMGGVVHTIVAPIERAKLLLQTQESNIAIVGDEGHAGKRRFKGMFDFIFRT 89

Query: 237 PKEQGL 254
            +E+G+
Sbjct: 90  VREEGV 95



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           F G+ + +S I K DG+ G+YRG
Sbjct: 181 FRGIHHFLSTIHKKDGVRGIYRG 203


>At4g01100.1 68417.m00148 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 352

 Score = 47.6 bits (108), Expect = 8e-06
 Identities = 25/61 (40%), Positives = 37/61 (60%)
 Frame = +3

Query: 72  AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           +  K   AGG++  VS+TAVAP+ER+K+LLQVQ+       + +Y G V     I + +G
Sbjct: 37  SICKSLFAGGVAGGVSRTAVAPLERMKILLQVQN-----PHNIKYSGTVQGLKHIWRTEG 91

Query: 252 L 254
           L
Sbjct: 92  L 92


>At4g26180.1 68417.m03768 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 325

 Score = 46.8 bits (106), Expect = 1e-05
 Identities = 23/60 (38%), Positives = 39/60 (65%)
 Frame = +3

Query: 75  FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           FAK+ +AGG++  ++KTAVAP+ER+K+L Q +        + +  G+V +  +I K +GL
Sbjct: 17  FAKELIAGGVTGGIAKTAVAPLERIKILFQTRR------DEFKRIGLVGSINKIGKTEGL 70



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 25/77 (32%), Positives = 38/77 (49%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G + F+RGN A+V R  P  AL++   ++Y++  + G    T   R              
Sbjct: 69  GLMGFYRGNGASVARIVPYAALHYMAYEEYRRWIIFGFPDTT---RGPLLDLVAGSFAGG 125

Query: 428 TSLCFVYPLDFARTRLA 478
           T++ F YPLD  RT+LA
Sbjct: 126 TAVLFTYPLDLVRTKLA 142



 Score = 33.1 bits (72), Expect = 0.19
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR-YKGIVDAFVRIPKEQG 251
           D +AG  +   +     P++ V+  L  Q   K I  +Q  Y+GIVD F R  +E G
Sbjct: 116 DLVAGSFAGGTAVLFTYPLDLVRTKLAYQTQVKAIPVEQIIYRGIVDCFSRTYRESG 172



 Score = 29.5 bits (63), Expect = 2.3
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +1

Query: 517 GLGNCISKIFKSDGLIGLYRGFG 585
           GL   I+KI K++GL+G YRG G
Sbjct: 56  GLVGSINKIGKTEGLMGFYRGNG 78


>At1g78180.1 68414.m09110 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 342

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 31/87 (35%), Positives = 41/87 (47%), Gaps = 2/87 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFL--GGVDKKTQFWRYFXXXXXXXXXX 421
           G   FW+GN  NV+R  P +A+NF   D Y++  L   G  + T F R+           
Sbjct: 97  GLTGFWKGNLLNVLRTAPFKAVNFCAYDTYRKQLLKIAGNQEATNFERF---VAGAAAGI 153

Query: 422 XXTSLCFVYPLDFARTRLAADVGKGDG 502
             T LC   PLD  RT+L A  G+  G
Sbjct: 154 TATVLCL--PLDTIRTKLVARGGEALG 178



 Score = 31.9 bits (69), Expect = 0.44
 Identities = 14/25 (56%), Positives = 19/25 (76%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKL 155
           K   AG ++A VSKT +AP+ER+KL
Sbjct: 50  KHLWAGAVAAMVSKTFLAPLERLKL 74


>At3g51870.1 68416.m05688 mitochondrial substrate carrier family
           protein peroxisomal Ca-dependent solute carrier -
           Oryctolagus cuniculus, EMBL:AF004161
          Length = 381

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 23/72 (31%), Positives = 41/72 (56%)
 Frame = +3

Query: 39  SNKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIV 218
           +N ++ LA     A  F AG ++ A +KT  AP++R+KLL+Q   +     + ++  G +
Sbjct: 75  NNPLAILALVPKDAAIFAAGALAGAAAKTVTAPLDRIKLLMQTHGIRLGQQSAKKAIGFI 134

Query: 219 DAFVRIPKEQGL 254
           +A   I KE+G+
Sbjct: 135 EAITLIAKEEGV 146



 Score = 41.5 bits (93), Expect = 5e-04
 Identities = 25/79 (31%), Positives = 33/79 (41%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G   +W+GN   VIR  P  A+     + YK +F G  D+ +   R              
Sbjct: 145 GVKGYWKGNLPQVIRVLPYSAVQLLAYESYKNLFKGKDDQLSVIGR-----LAAGACAGM 199

Query: 428 TSLCFVYPLDFARTRLAAD 484
           TS    YPLD  R RLA +
Sbjct: 200 TSTLLTYPLDVLRLRLAVE 218



 Score = 27.5 bits (58), Expect = 9.5
 Identities = 11/24 (45%), Positives = 14/24 (58%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGF 582
           +  +    + I   DGLIGLYRGF
Sbjct: 312 YKSIPEAFAGIIDRDGLIGLYRGF 335


>At1g14560.1 68414.m01731 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 331

 Score = 45.2 bits (102), Expect = 4e-05
 Identities = 25/64 (39%), Positives = 40/64 (62%), Gaps = 2/64 (3%)
 Frame = +3

Query: 33  T*SNKMSNLADPV-AFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ-HVSKQIAADQRY 206
           T S  + +L D +   AK  +AGG + A++KTAVAP+ER+K+LLQ + +  K +   Q  
Sbjct: 8   TLSADVMSLVDTLPVLAKTLIAGGAAGAIAKTAVAPLERIKILLQTRTNDFKTLGVSQSL 67

Query: 207 KGIV 218
           K ++
Sbjct: 68  KKVL 71



 Score = 40.7 bits (91), Expect = 0.001
 Identities = 29/93 (31%), Positives = 42/93 (45%)
 Frame = +2

Query: 209 GYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRY 388
           G  + L+   Q  G L F++GN A+VIR  P  AL++   + Y+   L   +K       
Sbjct: 62  GVSQSLKKVLQFDGPLGFYKGNGASVIRIIPYAALHYMTYEVYRDWIL---EKNLPLGSG 118

Query: 389 FXXXXXXXXXXXXTSLCFVYPLDFARTRLAADV 487
                        T++   YPLD ART+LA  V
Sbjct: 119 PIVDLVAGSAAGGTAVLCTYPLDLARTKLAYQV 151


>At5g51050.1 68418.m06328 mitochondrial substrate carrier family
           protein similar to peroxisomal Ca-dependent solute
           carrier [Oryctolagus cuniculus] GI:2352427; contains
           INTERPRO:IPR001993 Mitochondrial substrate carrier
           family, INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 487

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 18/34 (52%), Positives = 27/34 (79%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQI 188
           F+AGGI+ A S+TA AP++R+K+LLQ+Q    +I
Sbjct: 212 FIAGGIAGAASRTATAPLDRLKVLLQIQKTDARI 245


>At5g01500.1 68418.m00064 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 415

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           F AG  + A +K+  AP++R+KLL+Q   V     + ++  G ++A   I KE+G+
Sbjct: 119 FFAGAFAGAAAKSVTAPLDRIKLLMQTHGVRAGQQSAKKAIGFIEAITLIGKEEGI 174



 Score = 39.5 bits (88), Expect = 0.002
 Identities = 25/81 (30%), Positives = 34/81 (41%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYFXXXXXXXXXXXX 427
           G   +W+GN   VIR  P  A+     + YK++F G   + +   R              
Sbjct: 173 GIKGYWKGNLPQVIRIVPYSAVQLFAYETYKKLFRGKDGQLSVLGR-----LGAGACAGM 227

Query: 428 TSLCFVYPLDFARTRLAADVG 490
           TS    YPLD  R RLA + G
Sbjct: 228 TSTLITYPLDVLRLRLAVEPG 248


>At3g55640.1 68416.m06182 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 332

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 25/59 (42%), Positives = 33/59 (55%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           A   LAGG++ A SKT  AP+ R+ +L QVQ +    AA  R   I+    RI  E+GL
Sbjct: 35  ASQLLAGGLAGAFSKTCTAPLSRLTILFQVQGMHTNAAA-LRKPSILHEASRILNEEGL 92



 Score = 37.5 bits (83), Expect = 0.009
 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 3/81 (3%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQ---VFLGGVDKKTQFWRYFXXXXXXXXX 418
           G  +FW+GN   +    P  ++NF   + YK+   +  G  + K                
Sbjct: 91  GLKAFWKGNLVTIAHRLPYSSVNFYAYEHYKKFMYMVTGMENHKEGISSNLFVHFVAGGL 150

Query: 419 XXXTSLCFVYPLDFARTRLAA 481
              T+    YPLD  RTRLAA
Sbjct: 151 AGITAASATYPLDLVRTRLAA 171



 Score = 27.5 bits (58), Expect = 9.5
 Identities = 9/25 (36%), Positives = 17/25 (68%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           +SG+ + +  I   +G++GLY+G G
Sbjct: 178 YSGIWHTLRSITTDEGILGLYKGLG 202


>At5g61810.1 68418.m07756 mitochondrial substrate carrier family
           protein similar to peroxisomal Ca-dependent solute
           carrier, Oryctolagus cuniculus,GI:2352427; contains
           INTERPRO:IPR001993 Mitochondrial substrate carrier
           family, INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 478

 Score = 42.3 bits (95), Expect = 3e-04
 Identities = 19/34 (55%), Positives = 27/34 (79%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS 179
           +K  LAGGI+ AVS+TA AP++R+K+ LQVQ  +
Sbjct: 205 SKLLLAGGIAGAVSRTATAPLDRLKVALQVQRTN 238



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 13/25 (52%), Positives = 20/25 (80%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQ 164
           LAGG++ AV++TA+ P++ VK  LQ
Sbjct: 300 LAGGLAGAVAQTAIYPMDLVKTRLQ 324


>At5g07320.1 68418.m00836 mitochondrial substrate carrier family
           protein similar to peroxisomal Ca-dependent solute
           carrier [Oryctolagus cuniculus] GI:2352427
           (mitochondrial carrier superfamily); contains
           INTERPRO:IPR001993 Mitochondrial substrate carrier
           family, INTERPRO:IPR002048 calcium-binding EF-hand
           domain
          Length = 479

 Score = 41.1 bits (92), Expect = 7e-04
 Identities = 17/27 (62%), Positives = 25/27 (92%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQ 170
           LAGG++ AVS+TA AP++R+K++LQVQ
Sbjct: 210 LAGGLAGAVSRTATAPLDRLKVVLQVQ 236



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 18/48 (37%), Positives = 31/48 (64%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVR 233
           +AGG++ A+++TA+ P++ VK  LQ   VS+   A + +K   D +VR
Sbjct: 301 MAGGMAGALAQTAIYPMDLVKTRLQT-CVSEGGKAPKLWKLTKDIWVR 347


>At5g64970.1 68418.m08172 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 428

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 2/87 (2%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYK-QVF-LGGVDKKTQFWRYFXXXXXXXXXX 421
           G   FW+GN  N++R  P +++NF   D Y+ Q+  L G ++ T F R+           
Sbjct: 180 GIRGFWKGNLVNILRTAPFKSINFYAYDTYRGQLLKLSGNEETTNFERF-----VAGAAA 234

Query: 422 XXTSLCFVYPLDFARTRLAADVGKGDG 502
             T+     PLD  RT + A  G+  G
Sbjct: 235 GVTASLLCLPLDTIRTVMVAPGGEALG 261



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 15/34 (44%), Positives = 21/34 (61%)
 Frame = +3

Query: 54  NLADPVAFAKDFLAGGISAAVSKTAVAPIERVKL 155
           N A  +   K   AG  +A VS+T +AP+ER+KL
Sbjct: 124 NGAGALNTTKHLWAGAFAAMVSRTCIAPLERMKL 157


>At3g53940.1 68416.m05959 mitochondrial substrate carrier family
           protein
          Length = 365

 Score = 39.1 bits (87), Expect = 0.003
 Identities = 23/54 (42%), Positives = 31/54 (57%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           LAGGI+ A SKT  AP+ R+ +L Q+Q +  + AA      I     RI KE+G
Sbjct: 74  LAGGIAGAFSKTCTAPLARLTILFQIQGMQSE-AAILSSPNIWHEASRIVKEEG 126



 Score = 32.7 bits (71), Expect = 0.25
 Identities = 25/82 (30%), Positives = 32/82 (39%), Gaps = 4/82 (4%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG----VDKKTQFWRYFXXXXXXXX 415
           G  +FW+GN   V    P  A+NF   ++YK  FL         K               
Sbjct: 126 GFRAFWKGNLVTVAHRLPYGAVNFYAYEEYK-TFLHSNPVLQSYKGNAGVDISVHFVSGG 184

Query: 416 XXXXTSLCFVYPLDFARTRLAA 481
               T+    YPLD  RTRL+A
Sbjct: 185 LAGLTAASATYPLDLVRTRLSA 206



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 9/25 (36%), Positives = 17/25 (68%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           + G+G+    I + +G++GLY+G G
Sbjct: 213 YQGVGHAFRTICREEGILGLYKGLG 237


>At3g48850.1 68416.m05335 mitochondrial phosphate transporter,
           putative similar to mitochondrial phosphate transporter
           GI:3318617 from [Arabidopsis thaliana]
          Length = 363

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 22/71 (30%), Positives = 36/71 (50%)
 Frame = +3

Query: 42  NKMSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 221
           N+   +  P  FA   +AG +S  ++ TA+ P++ +K  +Q+  +        +YK I  
Sbjct: 56  NEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNMQIDPL--------KYKNITS 107

Query: 222 AFVRIPKEQGL 254
           AF    KEQGL
Sbjct: 108 AFKTTIKEQGL 118


>At2g37890.1 68415.m04651 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 337

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 17/41 (41%), Positives = 27/41 (65%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQR 203
           ++ LAGGI+ A+SKT  AP+ R+ +L Q+Q +  + A   R
Sbjct: 43  QNLLAGGIAGAISKTCTAPLARLTILFQLQGMQSEGAVLSR 83



 Score = 36.3 bits (80), Expect = 0.020
 Identities = 24/81 (29%), Positives = 32/81 (39%), Gaps = 3/81 (3%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYF---XXXXXXXXX 418
           G  +FW+GN   V+   P  A+NF   +KY   F      ++                  
Sbjct: 98  GYRAFWKGNLVTVVHRIPYTAVNFYAYEKYNLFFNSNPVVQSFIGNTSGNPIVHFVSGGL 157

Query: 419 XXXTSLCFVYPLDFARTRLAA 481
              T+    YPLD  RTRLAA
Sbjct: 158 AGITAATATYPLDLVRTRLAA 178



 Score = 29.1 bits (62), Expect = 3.1
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           ++GG++ AVS TA  P++ V+  +QV+    +  A     G+   F  I K +G
Sbjct: 248 VSGGLAGAVSSTATYPLDLVRRRMQVEGAGGR--ARVYNTGLFGTFKHIFKSEG 299


>At1g14140.1 68414.m01671 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 305

 Score = 36.7 bits (81), Expect = 0.015
 Identities = 17/68 (25%), Positives = 34/68 (50%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           +N ++ +  A   L GG S  +++   +P + VK+ +Q            RY G ++AF 
Sbjct: 106 TNNSESLPLATKALVGGFSGVIAQVVASPADLVKVRMQADGRLVSQGLKPRYSGPIEAFT 165

Query: 231 RIPKEQGL 254
           +I + +G+
Sbjct: 166 KILQSEGV 173


>At1g25380.1 68414.m03150 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 363

 Score = 36.3 bits (80), Expect = 0.020
 Identities = 13/23 (56%), Positives = 21/23 (91%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           +SG+ +CI+K+F+S+G+ GLYRG
Sbjct: 258 YSGVIDCITKVFRSEGIPGLYRG 280



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 18/53 (33%), Positives = 30/53 (56%)
 Frame = +3

Query: 93  AGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           AG  + A++ T V P++ +K  LQV  + +  A+ QR   I+ +   I KE+G
Sbjct: 23  AGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIKEEG 75



 Score = 28.3 bits (60), Expect = 5.4
 Identities = 18/70 (25%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           ++   + +A   + A +  A  P+  VK  L  Q +   +     YK ++ AF RI  E+
Sbjct: 115 LSIGSNMIAAAGAGAATSIATNPLWVVKTRLMTQGIRPGVVP---YKSVMSAFSRICHEE 171

Query: 249 GL--FHSGVV 272
           G+   +SG++
Sbjct: 172 GVRGLYSGIL 181



 Score = 27.5 bits (58), Expect = 9.5
 Identities = 12/55 (21%), Positives = 28/55 (50%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           +A  I+  ++     P E ++  LQ Q   +   A+ +Y G++D   ++ + +G+
Sbjct: 222 IASSIAKVIASILTYPHEVIRAKLQEQGQIRN--AETKYSGVIDCITKVFRSEGI 274


>At2g47490.1 68415.m05928 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 312

 Score = 33.9 bits (74), Expect = 0.11
 Identities = 12/23 (52%), Positives = 17/23 (73%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRG 579
           +SG+ +CI K+F+ DG  G YRG
Sbjct: 252 YSGVRDCIKKVFEKDGFPGFYRG 274


>At4g39460.1 68417.m05583 mitochondrial substrate carrier family
           protein
          Length = 325

 Score = 33.1 bits (72), Expect = 0.19
 Identities = 17/57 (29%), Positives = 26/57 (45%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLF 257
           F+AGG +  V +TA+ PI+ +K  LQ      +I     Y G+      +     LF
Sbjct: 58  FIAGGTAGVVVETALYPIDTIKTRLQAARGGGKIVLKGLYSGLAGNIAGVLPASALF 114



 Score = 31.5 bits (68), Expect = 0.58
 Identities = 21/65 (32%), Positives = 34/65 (52%)
 Frame = +3

Query: 57  LADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRI 236
           L+DP    ++ L G  + A++     P++ +K  L VQ  +KQ      Y+GIVD    I
Sbjct: 224 LSDP----ENALIGAFAGALTGAVTTPLDVIKTRLMVQGSAKQ------YQGIVDCVQTI 273

Query: 237 PKEQG 251
            +E+G
Sbjct: 274 VREEG 278


>At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit,
           putative similar to U2 snRNP auxiliary factor, large
           subunit GB:CAA77136 from [Nicotiana plumbaginifolia]
          Length = 589

 Score = 32.3 bits (70), Expect = 0.33
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = -1

Query: 488 RHRRRDGYVRSRGGTRSTERWLRRHHRRPDYQ-RSNARTASSCQRRRG 348
           RHRRR    RSR  +RS  R    H  + +++ RS +R+ S  +RR G
Sbjct: 146 RHRRRS---RSRSRSRSERRSRSEHRHKSEHRSRSRSRSRSKSKRRSG 190


>At5g46800.1 68418.m05766 mitochondrial carnitine/acyl carrier,
           putative / a bout de souffle (BOU) / CAC-like protein
           identical to SP|Q93XM7 Mitochondrial
           carnitine/acylcarnitine carrier-like protein (A BOUT DE
           SOUFFLE) (Carnitine/acylcarnitine translocase-like
           protein) (CAC-like protein) {Arabidopsis thaliana};
           contains Pfam profile: PF00153 mitochondrial carrier
           protein
          Length = 300

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           +AGG++ A     V P + VK +LQV         + RY G +DAF +I K +G+
Sbjct: 218 MAGGVAGASFWGIVYPTDVVKSVLQVDDYK-----NPRYTGSMDAFRKILKSEGV 267



 Score = 30.7 bits (66), Expect = 1.0
 Identities = 12/25 (48%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           ++G  +   KI KS+G+ GLY+GFG
Sbjct: 251 YTGSMDAFRKILKSEGVKGLYKGFG 275


>At4g32400.1 68417.m04613 mitochondrial substrate carrier family
           protein
          Length = 392

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVA-PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           L  G  A VS+T +  P+E VK  L +Q           YKGI DAF++I +E+G
Sbjct: 208 LLAGACAGVSQTLLTYPLELVKTRLTIQRGV--------YKGIFDAFLKIIREEG 254



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/26 (46%), Positives = 19/26 (73%)
 Frame = +3

Query: 90  LAGGISAAVSKTAVAPIERVKLLLQV 167
           L+G ++ AVS+T VAP+E ++  L V
Sbjct: 115 LSGAVAGAVSRTVVAPLETIRTHLMV 140


>At2g46610.2 68415.m05813 arginine/serine-rich splicing factor,
           putative similar to SP|P92964 Arginine/serine-rich
           splicing factor RSP31 {Arabidopsis thaliana}
          Length = 224

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 28/79 (35%), Positives = 35/79 (44%)
 Frame = -1

Query: 584 PKPLYRPIRPSDLKILLMQFPRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRR 405
           P P+YR  RPS       + P  + Y G  PY  R+   Y     G RS++ + R   R 
Sbjct: 158 PSPVYRR-RPSP-DYTRRRSPEYDRYKGPAPYERRKSPDY-----GRRSSD-YGRARARS 209

Query: 404 PDYQRSNARTASSCQRRRG 348
           P Y RS     S  QR RG
Sbjct: 210 PGYDRSR----SPIQRARG 224


>At2g46610.1 68415.m05814 arginine/serine-rich splicing factor,
           putative similar to SP|P92964 Arginine/serine-rich
           splicing factor RSP31 {Arabidopsis thaliana}
          Length = 250

 Score = 31.9 bits (69), Expect = 0.44
 Identities = 28/79 (35%), Positives = 35/79 (44%)
 Frame = -1

Query: 584 PKPLYRPIRPSDLKILLMQFPRPENYAGHLPYRHRRRDGYVRSRGGTRSTERWLRRHHRR 405
           P P+YR  RPS       + P  + Y G  PY  R+   Y     G RS++ + R   R 
Sbjct: 184 PSPVYRR-RPSP-DYTRRRSPEYDRYKGPAPYERRKSPDY-----GRRSSD-YGRARARS 235

Query: 404 PDYQRSNARTASSCQRRRG 348
           P Y RS     S  QR RG
Sbjct: 236 PGYDRSR----SPIQRARG 250


>At4g24570.1 68417.m03521 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 313

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 5/65 (7%)
 Frame = +2

Query: 173 RQQADRRRPALQ-----GYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKY 337
           R QAD R P  Q     G    +R   +G G  S WRG+   + R     A   A  D++
Sbjct: 153 RMQADGRLPLAQRRNYAGVGDAIRSMVKGEGVTSLWRGSALTINRAMIVTAAQLASYDQF 212

Query: 338 KQVFL 352
           K+  L
Sbjct: 213 KEGIL 217


>At4g03115.1 68417.m00424 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 341

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +3

Query: 45  KMSNLADPVA-FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVD 221
           K  NL  P +     F   GIS A++     P++ VK+ LQ+QHV ++        G+  
Sbjct: 52  KPQNLIPPFSKVVSHFGISGISVALATGVTHPLDVVKVRLQMQHVGQR----GPLIGMTG 107

Query: 222 AFVRIPKEQG 251
            F+++ K +G
Sbjct: 108 IFLQLMKNEG 117


>At2g39970.1 68415.m04911 peroxisomal membrane protein (PMP36)
           identical to 36kDa-peroxisomal membrane protein (PMP36)
           GI:15146342 from [Arabidopsis thaliana]
          Length = 331

 Score = 31.1 bits (67), Expect = 0.77
 Identities = 18/63 (28%), Positives = 33/63 (52%)
 Frame = +3

Query: 69  VAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQ 248
           V   + FL G ++   +     P+  VK  LQ + V+      Q+YKG +DA +++ + +
Sbjct: 229 VTALETFLLGAVAKLGATVTTYPLLVVKSRLQAKQVTTGDKR-QQYKGTLDAILKMIRYE 287

Query: 249 GLF 257
           GL+
Sbjct: 288 GLY 290


>At3g21390.1 68416.m02700 mitochondrial substrate carrier family
           protein
          Length = 335

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 6/63 (9%)
 Frame = +3

Query: 84  DFLAGGISAAVSKTAVAPIERVKLLLQVQ------HVSKQIAADQRYKGIVDAFVRIPKE 245
           D  AGG++ A+S+   +P++ +K+  QVQ         K      +Y G+      I +E
Sbjct: 18  DASAGGVAGAISRMVTSPLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFRE 77

Query: 246 QGL 254
           +GL
Sbjct: 78  EGL 80



 Score = 29.9 bits (64), Expect = 1.8
 Identities = 25/98 (25%), Positives = 34/98 (34%), Gaps = 2/98 (2%)
 Frame = +2

Query: 194 RPALQGYRRRLRPHPQGAGSLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGG--VDK 367
           +P   G  R  +   +  G   FWRGN   ++   P  ++ FA   K K    G    + 
Sbjct: 61  KPKYNGLFRTTKDIFREEGLSGFWRGNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAEN 120

Query: 368 KTQFWRYFXXXXXXXXXXXXTSLCFVYPLDFARTRLAA 481
             Q   Y             T     YP D  RT LA+
Sbjct: 121 HAQLSPYLSYISGALAGCAAT--VGSYPFDLLRTVLAS 156


>At1g17110.1 68414.m02085 ubiquitin-specific protease 15 (UBP15)
           almost identical to ubiquitin-specific protease 15
           GI:11993475 [Arabidopsis thaliana], 7 amino acid
           difference
          Length = 924

 Score = 30.7 bits (66), Expect = 1.0
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = -1

Query: 548 LKILLMQFPRPENYAGHLPYRHRRRDGYVRSR 453
           L+  L QF RPE+  G   YR  R  GYVR+R
Sbjct: 600 LQDALTQFTRPEDLDGENMYRCSRCAGYVRAR 631


>At3g20240.1 68416.m02564 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier proteins
          Length = 348

 Score = 29.9 bits (64), Expect = 1.8
 Identities = 12/37 (32%), Positives = 25/37 (67%)
 Frame = +3

Query: 78  AKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQI 188
           A++FL+G ++ A++K  +AP+E ++  + V   S+ I
Sbjct: 49  AREFLSGALAGAMTKAVLAPLETIRTRMIVGVGSRSI 85



 Score = 27.9 bits (59), Expect = 7.2
 Identities = 12/25 (48%), Positives = 14/25 (56%)
 Frame = +2

Query: 239 QGAGSLSFWRGNFANVIRYFPTQAL 313
           Q  G    W GN  N+IR  PTQA+
Sbjct: 94  QKQGWQGLWAGNEINMIRIIPTQAI 118



 Score = 27.5 bits (58), Expect = 9.5
 Identities = 9/18 (50%), Positives = 16/18 (88%)
 Frame = +1

Query: 532 ISKIFKSDGLIGLYRGFG 585
           I+++ K +G++GLYRG+G
Sbjct: 298 IAEVVKKEGVMGLYRGWG 315


>At4g15210.1 68417.m02330 beta-amylase (BMY1) / 1,4-alpha-D-glucan
           maltohydrolase identical to Beta-amylase (EC 3.2.1.2)
           (1,4-alpha-D-glucan maltohydrolase) SP:P25853
           [Arabidopsis thaliana]
          Length = 498

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -3

Query: 594 HGHTETSVQT-NQTVGLEDLADAVSETGELRWPS 496
           +GH    ++T N  + LED+ADA   +G  +W S
Sbjct: 457 YGHEIVPLKTSNSQLTLEDIADAAQPSGAFKWDS 490


>At1g74240.1 68414.m08598 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 364

 Score = 29.5 bits (63), Expect = 2.3
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 2/65 (3%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL-- 254
           ++FL GGI+ A  +  + P++ +K  LQ Q +   + A QR K I+     +    GL  
Sbjct: 34  REFLWGGIAGAFGEGMMHPVDTLKTRLQSQII---MNATQRQKSILQMLRTVWVGDGLKG 90

Query: 255 FHSGV 269
           F+ G+
Sbjct: 91  FYRGI 95



 Score = 28.3 bits (60), Expect = 5.4
 Identities = 17/52 (32%), Positives = 29/52 (55%)
 Frame = +3

Query: 96  GGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG 251
           GG++  +S     P++ VK  LQVQ       +  +YKG +DA  +I +++G
Sbjct: 258 GGLAGGLSAYLTTPLDVVKTRLQVQ------GSTIKYKGWLDAVGQIWRKEG 303


>At5g66380.1 68418.m08370 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 308

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 2/48 (4%)
 Frame = +3

Query: 135 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQG--LFHSGVV 272
           PI  VK  LQ+Q    Q    Q Y G++DAF  I KE+G    + G+V
Sbjct: 126 PIWLVKTRLQLQTPLHQT---QPYSGLLDAFRTIVKEEGPRALYKGIV 170


>At5g58970.2 68418.m07388 uncoupling protein (UCP2) identical to
           uncoupling protein GI:4063007 from [Arabidopsis
           thaliana]
          Length = 272

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 18/68 (26%), Positives = 32/68 (47%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           S+    +   +  LA  ++ A++     P + VK+ LQ +         +RY G VDA+ 
Sbjct: 108 SDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYF 166

Query: 231 RIPKEQGL 254
            I K +G+
Sbjct: 167 TIVKLEGV 174


>At5g58970.1 68418.m07387 uncoupling protein (UCP2) identical to
           uncoupling protein GI:4063007 from [Arabidopsis
           thaliana]
          Length = 305

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 18/68 (26%), Positives = 32/68 (47%)
 Frame = +3

Query: 51  SNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFV 230
           S+    +   +  LA  ++ A++     P + VK+ LQ +         +RY G VDA+ 
Sbjct: 108 SDFIGDIPLYQKILAALLTGAIAIIVANPTDLVKVRLQSEG-KLPAGVPRRYAGAVDAYF 166

Query: 231 RIPKEQGL 254
            I K +G+
Sbjct: 167 TIVKLEGV 174


>At5g15640.1 68418.m01830 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 323

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 11/18 (61%), Positives = 14/18 (77%)
 Frame = +1

Query: 532 ISKIFKSDGLIGLYRGFG 585
           +  I K+DG+ GLYRGFG
Sbjct: 68  VKGILKNDGVPGLYRGFG 85



 Score = 28.7 bits (61), Expect = 4.1
 Identities = 13/25 (52%), Positives = 18/25 (72%)
 Frame = +1

Query: 511 FSGLGNCISKIFKSDGLIGLYRGFG 585
           ++G  +  +KI KS G+ GLYRGFG
Sbjct: 164 YTGGIDVATKIIKSYGVRGLYRGFG 188


>At2g17270.1 68415.m01995 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 309

 Score = 28.7 bits (61), Expect = 4.1
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +3

Query: 87  FLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL--FH 260
           FL+   +   +  A+ P E +K+ +Q Q +          KG++D F R+ + +GL  FH
Sbjct: 115 FLSSASAQIFADMALCPFEAIKVRVQTQPMFA--------KGLLDGFPRVYRSEGLAGFH 166

Query: 261 SGV 269
            G+
Sbjct: 167 RGL 169


>At4g08350.1 68417.m01380 KOW domain-containing transcription factor
           family protein chromatin structural protein homolog
           Supt5hp - Mus musculus,PID:g2754752
          Length = 1029

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 11/30 (36%), Positives = 18/30 (60%)
 Frame = -3

Query: 534 DAVSETGELRWPSPLPTSAARRVRAKSRGY 445
           D++S  G  + P+P+P+S  R  R +  GY
Sbjct: 655 DSLSRYGNFKAPAPVPSSPGRFQRGRGGGY 684


>At2g43770.1 68415.m05441 transducin family protein / WD-40 repeat
           family protein contains 7 WD-40 repeats (PF00400);
           similar to U5 snRNP-specific 40 kDa protein (GI:3820594)
           [Homo sapiens]
          Length = 343

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 14/47 (29%), Positives = 20/47 (42%), Gaps = 2/47 (4%)
 Frame = +2

Query: 248 GSLSFWRGNFANVIRYFPT--QALNFAFKDKYKQVFLGGVDKKTQFW 382
           G+   W       I+ FP   Q    +F D   ++F GGVD   + W
Sbjct: 161 GTAKLWDMRQRGAIQTFPDKYQITAVSFSDAADKIFTGGVDNDVKVW 207


>At2g35800.1 68415.m04396 mitochondrial substrate carrier family
           protein contains INTERPRO:IPR001993 Mitochondrial
           substrate carrier family, INTERPRO:IPR002048
           calcium-binding EF-hand domain
          Length = 823

 Score = 28.3 bits (60), Expect = 5.4
 Identities = 12/33 (36%), Positives = 22/33 (66%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVS 179
           K  LAGG+++A+S + + PI+ +K  +Q   +S
Sbjct: 543 KSALAGGLASALSTSLMHPIDTIKTRVQASTLS 575


>At1g72820.1 68414.m08419 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 349

 Score = 27.9 bits (59), Expect = 7.2
 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 3/24 (12%)
 Frame = +1

Query: 523 GNCISKIF---KSDGLIGLYRGFG 585
           G+CI   F   + +GL GLYRGFG
Sbjct: 62  GSCIKTAFTLVRHEGLRGLYRGFG 85


>At5g13590.1 68418.m01572 expressed protein 
          Length = 1190

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 7/63 (11%)
 Frame = -1

Query: 515  ENYAGHLPYRHRRR-DGYVRSRGGT-----RSTERWLRRHHRRP-DYQRSNARTASSCQR 357
            E ++GH  + HRR   GY   R  +      S E  +RRH+  P  ++ SNA       R
Sbjct: 972  EEFSGHTDFSHRRSPSGYKVERMSSPDHSGYSREMVVRRHNSPPFSHRPSNAGRGRGYAR 1031

Query: 356  RRG 348
             RG
Sbjct: 1032 GRG 1034


>At5g01340.1 68418.m00047 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 309

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 17/58 (29%), Positives = 26/58 (44%)
 Frame = +3

Query: 81  KDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGL 254
           +  ++G ++         P + VK  L  Q  S+      RYKG+V A   I  E+GL
Sbjct: 212 QSMISGFLAGTAGPFCTGPFDVVKTRLMAQ--SRDSEGGIRYKGMVHAIRTIYAEEGL 267


>At2g46320.1 68415.m05761 mitochondrial substrate carrier family
           protein contains Pfam profile: PF00153 mitochondrial
           carrier protein
          Length = 361

 Score = 27.5 bits (58), Expect = 9.5
 Identities = 9/25 (36%), Positives = 17/25 (68%)
 Frame = +3

Query: 177 SKQIAADQRYKGIVDAFVRIPKEQG 251
           S  + +D +YKG +D F +I +++G
Sbjct: 91  SASVCSDNQYKGTLDVFYKIIRQEG 115


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,532,984
Number of Sequences: 28952
Number of extensions: 250400
Number of successful extensions: 966
Number of sequences better than 10.0: 49
Number of HSP's better than 10.0 without gapping: 813
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 950
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1565336320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -