SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20004
         (768 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g55190.1 68418.m06880 Ras-related GTP-binding protein (RAN3) ...   186   1e-47
At5g20020.1 68418.m02382 Ras-related GTP-binding nuclear protein...   186   1e-47
At5g20010.1 68418.m02381 Ras-related GTP-binding nuclear protein...   186   1e-47
At5g55080.1 68418.m06866 Ras-related GTP-binding protein, putati...   158   3e-39
At4g39990.1 68417.m05663 Ras-related GTP-binding protein, putati...    57   1e-08
At3g15060.1 68416.m01905 Ras-related GTP-binding family protein ...    56   2e-08
At5g64990.1 68418.m08174 Ras-related GTP-binding protein, putati...    56   3e-08
At2g44610.1 68415.m05553 Ras-related GTP-binding protein, putati...    56   3e-08
At5g65270.1 68418.m08210 Ras-related GTP-binding family protein ...    56   3e-08
At4g39890.1 68417.m05651 Ras-related GTP-binding family protein ...    55   5e-08
At4g18430.1 68417.m02735 Ras-related GTP-binding protein, putati...    55   5e-08
At1g16920.1 68414.m02051 Ras-related GTP-binding protein, putati...    55   5e-08
At3g18820.1 68416.m02390 Ras-related GTP-binding protein, putati...    55   6e-08
At5g60860.1 68418.m07634 Ras-related GTP-binding protein, putati...    54   8e-08
At2g22290.1 68415.m02645 Ras-related GTP-binding protein, putati...    54   8e-08
At2g21880.1 68415.m02600 Ras-related GTP-binding protein, putati...    54   8e-08
At5g39620.1 68418.m04798 Ras-related GTP-binding protein, putati...    54   1e-07
At4g18800.1 68417.m02776 Ras-related GTP-binding family protein ...    54   1e-07
At5g59150.1 68418.m07413 Ras-related GTP-binding protein, putati...    53   2e-07
At5g62880.1 68418.m07890 Rac-like GTP-binding protein (ARAC10) i...    52   3e-07
At1g09630.1 68414.m01080 Ras-related GTP-binding protein, putati...    52   3e-07
At5g59840.1 68418.m07503 Ras-related GTP-binding family protein ...    52   4e-07
At3g53610.2 68416.m05922 Ras-related GTP-binding protein, putati...    52   4e-07
At3g53610.1 68416.m05921 Ras-related GTP-binding protein, putati...    52   4e-07
At3g46060.1 68416.m04984 Ras-related protein (ARA-3) / small GTP...    52   4e-07
At5g45970.1 68418.m05652 Rac-like GTP-binding protein (ARAC2) id...    52   6e-07
At4g35950.1 68417.m05115 Rac-like GTP-binding protein (ARAC6) id...    52   6e-07
At3g51300.1 68416.m05615 Rac-like GTP-binding protein (ARAC11) /...    52   6e-07
At2g17800.1 68415.m02063 Rac-like GTP-binding protein (ARAC1) (A...    52   6e-07
At4g35020.1 68417.m04967 Rac-like GTP-binding protein (ARAC3) / ...    51   7e-07
At4g17530.1 68417.m02622 Ras-related GTP-binding protein, putati...    51   7e-07
At1g07410.1 68414.m00790 Ras-related GTP-binding protein, putati...    51   7e-07
At5g45750.1 68418.m05624 Ras-related GTP-binding protein, putati...    51   1e-06
At3g48040.1 68416.m05237 Rac-like GTP-binding protein (ARAC8) id...    51   1e-06
At1g06400.1 68414.m00677 Ras-related GTP-binding protein (ARA-2)...    51   1e-06
At5g47200.1 68418.m05820 Ras-related GTP-binding protein, putati...    50   1e-06
At4g28950.1 68417.m04136 Rac-like GTP-binding protein (ARAC7) id...    50   1e-06
At3g07410.1 68416.m00883 Ras-related GTP-binding family protein ...    50   1e-06
At1g75840.1 68414.m08809 Rac-like GTP-binding protein (ARAC5) / ...    50   1e-06
At1g28550.1 68414.m03513 Ras-related GTP-binding protein, putati...    50   1e-06
At1g20090.1 68414.m02514 Rac-like GTP-binding protein (ARAC4) / ...    50   2e-06
At5g47960.1 68418.m05925 Ras-related GTP-binding family protein ...    50   2e-06
At1g22740.1 68414.m02841 Ras-related protein (RAB7) / AtRab75 / ...    50   2e-06
At3g46830.1 68416.m05083 Ras-related protein (RAB11A) / small GT...    49   3e-06
At1g49300.1 68414.m05526 Ras-related GTP-binding protein, putati...    49   3e-06
At1g01200.1 68414.m00034 Ras-related GTP-binding protein, putati...    49   3e-06
At2g33870.1 68415.m04158 Ras-related GTP-binding protein, putati...    49   4e-06
At1g02130.1 68414.m00139 Ras-related protein (ARA-5) / small GTP...    49   4e-06
At5g47520.1 68418.m05867 Ras-related GTP-binding protein, putati...    48   7e-06
At1g05810.1 68414.m00608 Ras-related protein (ARA-1) (ARA) / sma...    48   7e-06
At5g03520.1 68418.m00308 Ras-related GTP-binding protein, putati...    48   9e-06
At3g09900.1 68416.m01180 Ras-related GTP-binding protein, putati...    48   9e-06
At3g12160.1 68416.m01516 Ras-related GTP-binding family protein ...    47   1e-05
At1g52280.1 68414.m05899 Ras-related GTP-binding protein, putati...    46   2e-05
At3g16100.1 68416.m02034 Ras-related GTP-binding family protein ...    46   3e-05
At4g17160.1 68417.m02582 Ras-related GTP-binding protein, putati...    45   5e-05
At4g09720.1 68417.m01596 Ras-related GTP-binding protein, putati...    45   5e-05
At3g11730.1 68416.m01439 Ras-related GTP-binding protein, putati...    45   5e-05
At1g18200.1 68414.m02264 Ras-related GTP-binding family protein ...    45   5e-05
At2g44690.1 68415.m05562 Rac-like GTP-binding protein (ARAC9) id...    45   6e-05
At2g43130.1 68415.m05356 Ras-related protein (ARA-4) / small GTP...    44   8e-05
At2g31680.1 68415.m03867 Ras-related GTP-binding protein, putati...    44   1e-04
At4g17170.1 68417.m02583 Rab2-like GTP-binding protein (RAB2) id...    43   2e-04
At1g73640.1 68414.m08525 Ras-related GTP-binding family protein ...    43   2e-04
At4g35860.1 68417.m05093 Ras-related GTP-binding protein, putati...    43   3e-04
At5g45130.1 68418.m05540 Ras-related protein (RHA1) / small GTP-...    41   0.001
At5g54840.1 68418.m06830 GTP-binding family protein similar to S...    40   0.002
At4g19640.1 68417.m02884 Ras-related GTP-binding protein, putati...    40   0.002
At3g54840.1 68416.m06076 Rab GTPase (ARA6) identical to small GT...    40   0.002
At3g21700.2 68416.m02735 expressed protein                             39   0.004
At3g21700.1 68416.m02736 expressed protein                             39   0.004
At5g10260.1 68418.m01191 Ras-related GTP-binding protein, putati...    38   0.006
At5g54840.2 68418.m06831 GTP-binding family protein similar to S...    38   0.007
At3g09910.1 68416.m01181 Ras-related GTP-binding protein, putati...    38   0.010
At1g43890.1 68414.m05059 Ras-related GTP-binding protein, putati...    38   0.010
At3g21700.3 68416.m02737 expressed protein                             37   0.013
At5g46025.1 68418.m05660 Ras-related GTP-binding family protein ...    36   0.030
At5g65960.1 68418.m08303 expressed protein                             35   0.052
At5g27540.1 68418.m03297 GTP-binding protein-related low similar...    35   0.069
At5g03530.1 68418.m00309 Ras-related GTP-binding family protein ...    34   0.091
At4g09720.2 68417.m01597 Ras-related GTP-binding protein, putati...    31   0.64 
At1g02440.1 68414.m00192 ADP-ribosylation factor, putative simil...    31   0.64 
At1g22040.1 68414.m02757 kelch repeat-containing F-box family pr...    31   0.85 
At3g13640.1 68416.m01718 RNase L inhibitor protein, putative sim...    30   1.5  
At3g05310.1 68416.m00579 GTP-binding protein-related low similar...    30   2.0  
At5g37150.1 68418.m04460 tRNA-splicing endonuclease positive eff...    29   2.6  
At4g30300.1 68417.m04306 ABC transporter family protein ribonucl...    29   3.4  
At4g21800.2 68417.m03154 ATP-binding family protein contains Pfa...    29   3.4  
At4g21800.1 68417.m03153 ATP-binding family protein contains Pfa...    29   3.4  
At5g44110.1 68418.m05397 ABC transporter family protein                29   4.5  
At5g32405.1 68418.m03813 hypothetical protein                          29   4.5  
At1g03905.1 68414.m00375 ABC transporter family protein similar ...    29   4.5  
At2g15310.1 68415.m01746 ADP-ribosylation factor, putative simil...    28   6.0  
At5g02270.1 68418.m00150 ABC transporter family protein NBD-like...    28   7.9  
At1g03160.1 68414.m00293 GTP-binding protein-related contains TI...    28   7.9  

>At5g55190.1 68418.m06880 Ras-related GTP-binding protein (RAN3)
           identical to atran3 [Arabidopsis thaliana] GI:2058280
          Length = 221

 Score =  186 bits (454), Expect = 1e-47
 Identities = 86/136 (63%), Positives = 98/136 (72%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D P+FK V+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+    C   
Sbjct: 10  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDT 69

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L            +MFDVT+R+TYKNVP WHRDL RVCE IPIVLCGNKVD+
Sbjct: 70  AGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV 129

Query: 461 KDRKVKAKTIVFHRKK 508
           K+R+VKAK + FHRKK
Sbjct: 130 KNRQVKAKQVTFHRKK 145



 Score =  124 bits (298), Expect = 9e-29
 Identities = 71/131 (54%), Positives = 81/131 (61%), Gaps = 2/131 (1%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAIS--HVRRNLSSYVQKCT*LA*RFGPCM*RYP 429
           IRF  WDTAGQEKFGGLRDGYYI GQCAI    V   L+ Y    T        C    P
Sbjct: 62  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLT-YKNVPTWHRDLCRVCE-NIP 119

Query: 430 YCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
             L   +     ++   +   F ++K+LQYY+ISAKSNYNFEKPFL+LARKL GD NL F
Sbjct: 120 IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDANLHF 179

Query: 610 VAMPALLPPEV 642
           V  PAL PPEV
Sbjct: 180 VESPALAPPEV 190


>At5g20020.1 68418.m02382 Ras-related GTP-binding nuclear protein
           (RAN-2) identical to GTP-binding nuclear protein RAN-2
           SP:P41917 from [Arabidopsis thaliana]
          Length = 221

 Score =  186 bits (454), Expect = 1e-47
 Identities = 86/136 (63%), Positives = 98/136 (72%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D P+FK V+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+    C   
Sbjct: 10  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDT 69

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L            +MFDVT+R+TYKNVP WHRDL RVCE IPIVLCGNKVD+
Sbjct: 70  AGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV 129

Query: 461 KDRKVKAKTIVFHRKK 508
           K+R+VKAK + FHRKK
Sbjct: 130 KNRQVKAKQVTFHRKK 145



 Score =  126 bits (304), Expect = 2e-29
 Identities = 74/145 (51%), Positives = 87/145 (60%), Gaps = 2/145 (1%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAIS--HVRRNLSSYVQKCT*LA*RFGPCM*RYP 429
           IRF  WDTAGQEKFGGLRDGYYI GQCAI    V   L+ Y    T        C    P
Sbjct: 62  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLT-YKNVPTWHRDLCRVCE-NIP 119

Query: 430 YCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
             L   +     ++   +   F ++K+LQYY+ISAKSNYNFEKPFL+LARKL GD NL F
Sbjct: 120 IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHF 179

Query: 610 VAMPALLPPEVTMGSSMAEPN*KDL 684
           V  PAL PPEV +  +  + N  DL
Sbjct: 180 VESPALAPPEVHLDIAAQQQNEADL 204


>At5g20010.1 68418.m02381 Ras-related GTP-binding nuclear protein
           (RAN-1) identical to GTP-binding nuclear protein RAN-1
           SP:P41916 from [Arabidopsis thaliana]
          Length = 221

 Score =  186 bits (454), Expect = 1e-47
 Identities = 86/136 (63%), Positives = 98/136 (72%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D P+FK V+VGDGGTGKTTFVKRHLTGEFEKKY  T+GVEVHPL F TN G+    C   
Sbjct: 10  DYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDT 69

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L            +MFDVT+R+TYKNVP WHRDL RVCE IPIVLCGNKVD+
Sbjct: 70  AGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDV 129

Query: 461 KDRKVKAKTIVFHRKK 508
           K+R+VKAK + FHRKK
Sbjct: 130 KNRQVKAKQVTFHRKK 145



 Score =  123 bits (297), Expect = 1e-28
 Identities = 73/145 (50%), Positives = 87/145 (60%), Gaps = 2/145 (1%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAIS--HVRRNLSSYVQKCT*LA*RFGPCM*RYP 429
           IRF  WDTAGQEKFGGLRDGYYI GQCAI    V   L+ Y    T        C    P
Sbjct: 62  IRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLT-YKNVPTWHRDLCRVCE-NIP 119

Query: 430 YCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEF 609
             L   +     ++   +   F ++K+LQYY+ISAKSNYNFEKPFL+LARKL GD NL F
Sbjct: 120 IVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDQNLHF 179

Query: 610 VAMPALLPPEVTMGSSMAEPN*KDL 684
           V  PAL PPEV +  +  + N  +L
Sbjct: 180 VETPALAPPEVHIDIADQQKNEAEL 204


>At5g55080.1 68418.m06866 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein atran3 GI:2058280 from
           [Arabidopsis thaliana]
          Length = 222

 Score =  158 bits (384), Expect = 3e-39
 Identities = 72/136 (52%), Positives = 92/136 (67%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           D+PTFK ++VGDGGTGKTTF+KRHLTGEFE     TLGV+++PL F TNRG+    C   
Sbjct: 10  DLPTFKLLIVGDGGTGKTTFLKRHLTGEFEHNTEPTLGVDIYPLDFFTNRGKIRFECWDT 69

Query: 281 PDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNKVDI 460
             +     L+           +MFDVT+R TY N+  W+RDL RVC+ IPIVLCGNKVD+
Sbjct: 70  AGQEKYSGLKDAYYIHGQCAIIMFDVTARHTYMNIDRWYRDLRRVCKNIPIVLCGNKVDV 129

Query: 461 KDRKVKAKTIVFHRKK 508
             R++K K + +HRKK
Sbjct: 130 PSRQIKPKHVSYHRKK 145



 Score = 91.1 bits (216), Expect = 7e-19
 Identities = 52/129 (40%), Positives = 72/129 (55%), Gaps = 7/129 (5%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYYIQGQCAI-------SHVRRNLSSYVQKCT*LA*RFGPC 414
           IRF  WDTAGQEK+ GL+D YYI GQCAI        H   N+  + +    +      C
Sbjct: 62  IRFECWDTAGQEKYSGLKDAYYIHGQCAIIMFDVTARHTYMNIDRWYRDLRRV------C 115

Query: 415 M*RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLIGD 594
               P  L   +     ++   ++  + ++K LQYY++SAK+N NFEKPFL+LAR++ GD
Sbjct: 116 K-NIPIVLCGNKVDVPSRQIKPKHVSYHRKKCLQYYEMSAKNNCNFEKPFLYLARRIAGD 174

Query: 595 GNLEFVAMP 621
             L FV  P
Sbjct: 175 AKLSFVESP 183


>At4g39990.1 68417.m05663 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:303738 from [Pisum
           sativum]
          Length = 224

 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF     AT+GVE         +      +  T   +
Sbjct: 18  FKVVLIGDSAVGKSQLLARFARDEFSMDSKATIGVEFQTRTLSIEQKSIKAQIWDTAGQE 77

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   V  T   ++  V   +++D+T R T++++P W  +L     + I I+L GNK D++
Sbjct: 78  RYRAV--TSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDLE 135

Query: 464 DRK 472
           D++
Sbjct: 136 DQR 138


>At3g15060.1 68416.m01905 Ras-related GTP-binding family protein
           similar to GTP-binding protein GI:303742 from [Pisum
           sativum]; contains Pfam profile: PF00071 ras family
          Length = 217

 Score = 56.4 bits (130), Expect = 2e-08
 Identities = 37/120 (30%), Positives = 61/120 (50%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           +K VL+GD G GK+  + R    EF  +  +T+GVE      H +       +  T   +
Sbjct: 14  YKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDEKIVKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +DVT  VT++NV  W ++L    E  I I+L GNK D++
Sbjct: 74  RYRAI--TSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTEANIVIMLVGNKADLR 131


>At5g64990.1 68418.m08174 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:550072 from [Homo
           sapiens]
          Length = 206

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 36/129 (27%), Positives = 60/129 (46%), Gaps = 2/129 (1%)
 Frame = +2

Query: 92  MADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMC 271
           M D    +K V +GD G GKT+ +   + G+F+  Y AT+G++            F L  
Sbjct: 1   MGDLGKGYKLVFLGDQGVGKTSIITCFMYGKFDTSYQATIGIDFLSKTTRYEDRTFRLQL 60

Query: 272 GTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCG 445
                +     L    I   +V  +++DV S+ ++ N   W  + VR   G  + IVL G
Sbjct: 61  WDTAGQERFKSLVPSYIRDSSVAVIVYDVASKQSFINTSKWIEE-VRAERGSYVIIVLVG 119

Query: 446 NKVDIKDRK 472
           NK D+ +++
Sbjct: 120 NKTDLVNKR 128


>At2g44610.1 68415.m05553 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:623586 from [Nicotiana
           tabacum] ; contains an ADP-ribosylation factors family
           signature for proteins involved in protein trafficking
          Length = 208

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 35/123 (28%), Positives = 66/123 (53%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           +K V +GD   GKT+ + R +  +F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 10  YKLVFLGDQSVGKTSIITRFMYDKFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 69

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIK 463
           R   ++ +  I   +V  +++DV SR ++ N   W  D VR   G  + +VL GNK D+ 
Sbjct: 70  RFRSLIPS-YIRDSSVAVIVYDVASRQSFLNTTKW-IDEVRTERGSDVIVVLVGNKTDLV 127

Query: 464 DRK 472
           D++
Sbjct: 128 DKR 130


>At5g65270.1 68418.m08210 Ras-related GTP-binding family protein
           similar to GTP-binding protein RAB11A GI:1370142 from
           [Lotus japonicus]; contains Pfam profile: PF00071 Ras
           family
          Length = 226

 Score = 55.6 bits (128), Expect = 3e-08
 Identities = 36/123 (29%), Positives = 61/123 (49%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHP-LVFHTNRGQFVLMCGTQPDK 289
           FK VL+GD   GK+  + R+   EF     AT+GVE     +   ++     +  T   +
Sbjct: 18  FKVVLIGDSAVGKSQILARYARDEFSLDSKATIGVEFQTRTLVIDHKSVKAQIWDTAGQE 77

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   V  T   ++  V   +++D+T R T+ ++P W  +L     + I I+L GNK D+ 
Sbjct: 78  RYRAV--TSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDLV 135

Query: 464 DRK 472
           D++
Sbjct: 136 DQR 138


>At4g39890.1 68417.m05651 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 214

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK V +GD   GKT+ + R +  +F+  Y  T+G++ +   ++  +R   + +  T   +
Sbjct: 10  FKLVFLGDQSVGKTSIITRFMYDKFDTTYQPTIGIDFLSKTMYLEDRTVRLQLWDTAGQE 69

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL--VRVCEGIPIVLCGNKVDIK 463
           R   ++ +  I   +V  V++DV++R T+ N   W  D+   R    + IVL GNK D+ 
Sbjct: 70  RFRSLIPS-YIRDSSVAIVVYDVSNRQTFLNTSKWIEDVHRERGQSNVIIVLVGNKTDLV 128

Query: 464 DRK 472
           +++
Sbjct: 129 EKR 131



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           S ++  E R +R  +WDTAGQE+F  L   Y      AI
Sbjct: 48  SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAI 86


>At4g18430.1 68417.m02735 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:303742 from [Pisum
           sativum]
          Length = 217

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE      H +       +  T   +
Sbjct: 14  FKLVLIGDSGVGKSNLLSRFTRNEFSIESKSTIGVEFATRSVHVDEKIIKAQLWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +D+T  +T++NV  W ++L       + I+L GNK D++
Sbjct: 74  RYRAI--TSAYYRGAVGALLVYDITRHITFENVERWLKELRDHTDANVVIMLVGNKADLR 131


>At1g16920.1 68414.m02051 Ras-related GTP-binding protein, putative
           similar to GTP binding protein GI:218228 from [Vicia
           faba]; identical to cDNA small GTP-binding protein
           (Rab11) GI:451859
          Length = 216

 Score = 55.2 bits (127), Expect = 5e-08
 Identities = 37/121 (30%), Positives = 63/121 (52%), Gaps = 4/121 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GK+  + R    EF  +  +T+GVE        + G+ V   +  T   
Sbjct: 14  FKVVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATRTLKVD-GKVVKAQIWDTAGQ 72

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI 460
           +R   +  T   ++  V +++ +DVT R T++NV  W ++L    +  I ++L GNK D+
Sbjct: 73  ERYRAI--TSAYYRGAVGALLVYDVTRRATFENVDRWLKELKNHTDPNIVVMLVGNKSDL 130

Query: 461 K 463
           +
Sbjct: 131 R 131


>At3g18820.1 68416.m02390 Ras-related GTP-binding protein, putative
           similar to Ras-related protein RAB7 GI:1370186 from
           [Pisum sativum], Plant Mol. Biol. 21 (6), 1195-1199
           (1993); contains Pfam profile: PF00071 Ras family
          Length = 206

 Score = 54.8 bits (126), Expect = 6e-08
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 5/122 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + +++  +F  +Y AT+G +            F L       +  
Sbjct: 10  KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNKVDI 460
              L        +   +++DV S  +++N+ NW  + L++      E  P VL GNKVD+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPFVLIGNKVDV 129

Query: 461 KD 466
            D
Sbjct: 130 DD 131



 Score = 37.5 bits (83), Expect = 0.010
 Identities = 35/149 (23%), Positives = 66/149 (44%), Gaps = 12/149 (8%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCA-----ISHVR--RNLSS 369
           G    +  + +E R     +WDTAGQE+F  L   +Y    C      ++ ++   NL++
Sbjct: 42  GADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNN 101

Query: 370 YVQKCT*LA*RFGPCM*RYPYCLVRKQ----SGY*RQKS*GENYCFPQEK-DLQYYDISA 534
           + ++    A    P    +P+ L+  +     G  R  S  +   +   K ++ Y++ SA
Sbjct: 102 WREEFLIQASPSDP--ENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSA 159

Query: 535 KSNYNFEKPFLWLARKLIGDGNLEFVAMP 621
           K   N E+ F  +A+  +  G  E + +P
Sbjct: 160 KVGTNVEEAFQCIAKDALKSGEEEELYLP 188


>At5g60860.1 68418.m07634 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:303742 from [Pisum
           sativum]
          Length = 217

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE      H  ++     +  T   +
Sbjct: 14  FKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKIVKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +DVT  VT++NV  W ++L       I I+  GNK D++
Sbjct: 74  RYRAI--TSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMFVGNKADLR 131


>At2g22290.1 68415.m02645 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:550072 from [Homo
           sapiens]
          Length = 207

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 32/122 (26%), Positives = 66/122 (54%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           +K V +GD   GKT+ + R +  +F+  Y AT+G++ +   ++  +R   + +  T   +
Sbjct: 10  YKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQE 69

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCEG-IPIVLCGNKVDIKD 466
           R   ++ +  I   +V  V++DV +R+++ N   W  ++     G + IVL GNK D+ +
Sbjct: 70  RFRSLIPS-YIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAGDVIIVLVGNKTDLVE 128

Query: 467 RK 472
           ++
Sbjct: 129 KR 130


>At2g21880.1 68415.m02600 Ras-related GTP-binding protein, putative
           similar to Ras family GTP-binding protein SP:Q43463 from
           [Glycine max]
          Length = 212

 Score = 54.4 bits (125), Expect = 8e-08
 Identities = 29/120 (24%), Positives = 56/120 (46%), Gaps = 5/120 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + +++  +F K+Y AT+G +      H +     L       +  
Sbjct: 11  KVIVLGDSGVGKTSLMNQYVYKKFNKQYKATIGADFVTKELHIDEKSVTLQIWDTAGQER 70

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-----EGIPIVLCGNKVDI 460
              L        +   +++DV +  +++ + NWH + ++       E  P VL GNK D+
Sbjct: 71  FQSLGAAFYRGADCCVLVYDVNNLKSFETLNNWHTEFLKQANPMEPETFPFVLIGNKTDV 130


>At5g39620.1 68418.m04798 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein RAB7A GI:1370182 from
           [Lotus japonicus]
          Length = 204

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 7/132 (5%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GKT+ +KR+   +F++ + +T+ V++          Q +L       +  
Sbjct: 7   KIILLGDSGVGKTSLLKRYNDKDFKQLHNSTIYVDLVTKEICIAERQVILQIWDTAGQER 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-----GIPIVLCGNKVDI 460
              L +      +   +++DV +  T++++ NWH + ++          P VL GNK D+
Sbjct: 67  FKSLPSRFYRDTDCCVLVYDVNTLKTFESIDNWHDEFIKQANPETPTKFPFVLMGNKTDV 126

Query: 461 KDRK--VKAKTI 490
            + K  V AK I
Sbjct: 127 NNGKPRVVAKEI 138


>At4g18800.1 68417.m02776 Ras-related GTP-binding family protein
           similar to ras-related GTP binding protein RIC2
           SP:P40393 from [Oryza sativa]; contains Pfam profile:
           PF00071 Ras family
          Length = 214

 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE      + N       +  T   +
Sbjct: 14  FKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSLNVNEKVIKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +DVT   T++NV  W R+L       I ++L GNK D++
Sbjct: 74  RYRAI--TSAYYRGAVGALLVYDVTRHSTFENVERWLRELRDHTDPNIVVMLVGNKSDLR 131


>At5g59150.1 68418.m07413 Ras-related GTP-binding protein, putative
           similar to Ras-related protein Rab11C SP:Q40193 from
           [Lotus japonicus]
          Length = 217

 Score = 52.8 bits (121), Expect = 2e-07
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 4/120 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GKT  + R    EF  +  +T+GVE          G+ V   +  T   
Sbjct: 13  FKIVLIGDSGVGKTNILSRFTRNEFCLESKSTIGVEFATRTLQV-EGKTVKAQIWDTAGQ 71

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   +  T   ++  V +++ +D+T R T+ NV  W R+L       I I++ GNK D+
Sbjct: 72  ERYRAI--TSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKADL 129


>At5g62880.1 68418.m07890 Rac-like GTP-binding protein (ARAC10)
           identical to rac GTP binding protein Arac10 [Arabidopsis
           thaliana] GI:3702964, rac-like GTP binding protein
           Arac10 [Arabidopsis thaliana] GI:7211193; contains Pfam
           profile: PF00071 Ras family
          Length = 215

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 4/131 (3%)
 Frame = +2

Query: 92  MADDMPTF-KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFV 262
           MA     F KCV VGDG  GKT  +  + + +F   Y+ T+      + +V  T     +
Sbjct: 1   MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL 60

Query: 263 LMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVL 439
                Q D   L  L   +    +V  + F + SR +Y+NV   W  +L     G+P+VL
Sbjct: 61  WDTAGQEDYNRLRPL---SYRGADVFVLSFSLVSRASYENVFKKWIPELQHFAPGVPLVL 117

Query: 440 CGNKVDIKDRK 472
            G K+D+++ K
Sbjct: 118 VGTKLDLREDK 128


>At1g09630.1 68414.m01080 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:1370146 from [Lotus
           japonicus]
          Length = 217

 Score = 52.4 bits (120), Expect = 3e-07
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 3/126 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGQFVLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE          R     +  T   +
Sbjct: 13  FKVVLIGDSGVGKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  + +++ +DVT   T++NV  W ++L       I I+L GNK D+K
Sbjct: 73  RYRAI--TSAYYRGALGALLVYDVTKPTTFENVSRWLKELRDHADSNIVIMLIGNKTDLK 130

Query: 464 DRKVKA 481
             +  A
Sbjct: 131 HLRAVA 136


>At5g59840.1 68418.m07503 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 216

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/120 (22%), Positives = 55/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R   G F   ++ T+G++        +  +  L       +  
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT   ++ N+ NW R++ +   + +  +L GNK D+ + K
Sbjct: 77  FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESK 136


>At3g53610.2 68416.m05922 Ras-related GTP-binding protein, putative
           similar to Ras-related protein ARA-3 SP:P28186 from
           [Arabidopsis thaliana]
          Length = 216

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/120 (22%), Positives = 55/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R   G F   ++ T+G++        +  +  L       +  
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT   ++ N+ NW R++ +   + +  +L GNK D+ + K
Sbjct: 77  FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDSVNKILVGNKADMDESK 136


>At3g53610.1 68416.m05921 Ras-related GTP-binding protein, putative
           similar to Ras-related protein ARA-3 SP:P28186 from
           [Arabidopsis thaliana]
          Length = 216

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/120 (22%), Positives = 55/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R   G F   ++ T+G++        +  +  L       +  
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT   ++ N+ NW R++ +   + +  +L GNK D+ + K
Sbjct: 77  FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDSVNKILVGNKADMDESK 136


>At3g46060.1 68416.m04984 Ras-related protein (ARA-3) / small
           GTP-binding protein, putative identical to SP|P28186
           Ras-related protein ARA-3 {Arabidopsis thaliana};
           contains Pfam profile: PF00071 Ras family
          Length = 216

 Score = 52.0 bits (119), Expect = 4e-07
 Identities = 27/120 (22%), Positives = 55/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R   G F   ++ T+G++        +  +  L       +  
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT   ++ N+ NW R++ +   + +  +L GNK D+ + K
Sbjct: 77  FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESK 136


>At5g45970.1 68418.m05652 Rac-like GTP-binding protein (ARAC2)
           identical to RAC-like GTP binding protein ARAC2
           SP:Q38903
          Length = 201

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 37/122 (30%), Positives = 56/122 (45%), Gaps = 3/122 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V  +     +     Q D 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWDTAGQEDY 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKD 466
             L  L        +V  + F + S+ +Y+N+   W  +L     GIPIVL G K+D++D
Sbjct: 68  NRLRPLSYRGA---DVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKLDLRD 124

Query: 467 RK 472
            K
Sbjct: 125 DK 126



 Score = 28.3 bits (60), Expect = 6.0
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 44  SANVVVDGSTVNLGLWDTAGQEDYNRLR 71


>At4g35950.1 68417.m05115 Rac-like GTP-binding protein (ARAC6)
           identical to rac-like GTP binding protein Arac6
           GI:3406757 from [Arabidopsis thaliana]
          Length = 197

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 36/120 (30%), Positives = 53/120 (44%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV VGDG  GKT  +  + +  F   YV T+       V   N     L       +  
Sbjct: 8   KCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVV-VNGATVNLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKDRK 472
              L   +    +V  + F + S+ +Y+NV   W  +L     G+PIVL G K+D++D K
Sbjct: 67  YNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDK 126


>At3g51300.1 68416.m05615 Rac-like GTP-binding protein (ARAC11) /
           Rho-like GTP-binding protein (ROP1) identical to GTP
           binding protein Rop1At [Arabidopsis thaliana]
           GI:2558666, rac-like GTP binding protein Arac11
           [Arabidopsis thaliana] GI:3603426
          Length = 197

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 36/120 (30%), Positives = 53/120 (44%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV VGDG  GKT  +  + +  F   YV T+       V   N     L       +  
Sbjct: 8   KCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVV-VNGSTVNLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKDRK 472
              L   +    +V  + F + S+ +Y+NV   W  +L     G+PIVL G K+D++D K
Sbjct: 67  YNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDK 126


>At2g17800.1 68415.m02063 Rac-like GTP-binding protein (ARAC1)
           (ATGP2) identical to Rac-like GTP-binding protein
           (ARAC1) SP:Q38902 from [Arabidopsis thaliana]
          Length = 197

 Score = 51.6 bits (118), Expect = 6e-07
 Identities = 36/120 (30%), Positives = 53/120 (44%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           KCV VGDG  GKT  +  + +  F   YV T+       V   N     L       +  
Sbjct: 8   KCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVV-VNGATVNLGLWDTAGQED 66

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKDRK 472
              L   +    +V  + F + S+ +Y+NV   W  +L     G+PIVL G K+D++D K
Sbjct: 67  YNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDK 126


>At4g35020.1 68417.m04967 Rac-like GTP-binding protein (ARAC3) /
           Rho-like GTP-binding protein (ROP6) identical to
           SP|Q38912 RAC-like GTP binding protein ARAC3
           (GTP-binding protein ROP6) {Arabidopsis thaliana};
           identical to cDNA Rho-like GTP binding protein (Rop6)
           GI:2645642
          Length = 198

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 36/122 (29%), Positives = 55/122 (45%), Gaps = 3/122 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V        +     Q D 
Sbjct: 8   KCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWDTAGQEDY 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
             L  L        +V  + F + S+ +Y+NV   W  +L     G+PI+L G K+D++D
Sbjct: 68  NRLRPLSYRGA---DVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRD 124

Query: 467 RK 472
            K
Sbjct: 125 DK 126



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   I   +WDTAGQE +  LR
Sbjct: 44  SANVIVDGNTINLGLWDTAGQEDYNRLR 71


>At4g17530.1 68417.m02622 Ras-related GTP-binding protein, putative
           very strong similarity to RAB1C [Lotus corniculatus var.
           japonicus] GI:1370166; contains Pfam profile PF00071:
           Ras family
          Length = 202

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     +   Y++T+GV+        +     L       + 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V +DVT   ++ NV  W  ++ R   E +  +L GNK D+  +
Sbjct: 69  RFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTSQ 128

Query: 470 KV 475
           KV
Sbjct: 129 KV 130


>At1g07410.1 68414.m00790 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein RAB11C GI:1370146 from
           [Lotus japonicus]
          Length = 214

 Score = 51.2 bits (117), Expect = 7e-07
 Identities = 37/120 (30%), Positives = 60/120 (50%), Gaps = 4/120 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GK+  + R    EF  +  +T+GVE          G+ V   +  T   
Sbjct: 13  FKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQV-EGKTVKAQIWDTAGQ 71

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   +  T   ++  V +++ +D+T R T++NV  W R+L       I I++ GNK D+
Sbjct: 72  ERYRAI--TSAYYRGAVGALLVYDITKRQTFENVLRWLRELRDHADSNIVIMMAGNKSDL 129


>At5g45750.1 68418.m05624 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:303744 from [Pisum
           sativum]
          Length = 216

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE      + +       +  T   +
Sbjct: 14  FKVVLIGDSGVGKSNLLSRFTKNEFSLESKSTIGVEFATRSLNVDDKVIKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +DVT   T++NV  W ++L    +  I ++L GNK D++
Sbjct: 74  RYRAI--TSAYYRGAVGALLVYDVTRHSTFENVETWLKELRNHTDPNIVVMLVGNKSDLR 131


>At3g48040.1 68416.m05237 Rac-like GTP-binding protein (ARAC8)
           identical to rac GTP binding protein Arac8 GI:3702966
           from [Arabidopsis thaliana]
          Length = 208

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 4/129 (3%)
 Frame = +2

Query: 92  MADDMPTF-KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFV 262
           MA     F KCV VGDG  GKT  +  + + +F   Y+ T+     V+ +V        +
Sbjct: 1   MASSASKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSVNVVVEGITVNLGL 60

Query: 263 LMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVL 439
                Q D   L  L        +V  + F + SR +Y+NV   W  +L     G+PIVL
Sbjct: 61  WDTAGQEDYNRLRPLSYRGA---DVFVLAFSLISRASYENVFKKWIPELQHFAPGVPIVL 117

Query: 440 CGNKVDIKD 466
            G K+D+++
Sbjct: 118 VGTKMDLRE 126


>At1g06400.1 68414.m00677 Ras-related GTP-binding protein (ARA-2)
           identical to Ras-related protein ARA-2 SP:P28185 from
           [Arabidopsis thaliana]
          Length = 216

 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 36/121 (29%), Positives = 59/121 (48%), Gaps = 4/121 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK VL+GD G GK+  + R    EF  +  +T+GVE          G+ V   +  T   
Sbjct: 14  FKLVLIGDSGVGKSNLLSRFTKNEFNLESKSTIGVEFATKTTKV-EGKVVKAQIWDTAGQ 72

Query: 287 KRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   +  T   ++  V +++ +DVT   T++N   W R+L       I ++L GNK D+
Sbjct: 73  ERYRAI--TSAYYRGAVGALLIYDVTRHATFENAARWLRELRGHTDPNIVVMLIGNKCDL 130

Query: 461 K 463
           +
Sbjct: 131 R 131


>At5g47200.1 68418.m05820 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:303750 from [Pisum
           sativum]
          Length = 202

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     +   Y++T+GV+        +     L       + 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + V +DVT   ++ NV  W  ++ R   E +  +L GNK D+  +
Sbjct: 69  RFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKNDLTSQ 128

Query: 470 KV 475
           KV
Sbjct: 129 KV 130


>At4g28950.1 68417.m04136 Rac-like GTP-binding protein (ARAC7)
           identical to rac GTP binding protein Arac7 GI:3702962
           from [Arabidopsis thaliana]
          Length = 209

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 36/121 (29%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV-LMCGTQPDKR 292
           KCV VGDG  GKT  +  + + +F   Y+ T+       V     GQ V L       + 
Sbjct: 8   KCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANV--AVDGQIVNLGLWDTAGQE 65

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVLCGNKVDIKDR 469
               L   +    ++  + F + S+ +Y+NV   W  +L R    +PIVL G K+D++D 
Sbjct: 66  DYSRLRPLSYRGADIFVLAFSLISKASYENVLKKWMPELRRFAPNVPIVLVGTKLDLRDD 125

Query: 470 K 472
           K
Sbjct: 126 K 126



 Score = 29.1 bits (62), Expect = 3.4
 Identities = 10/28 (35%), Positives = 18/28 (64%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  + + +   +WDTAGQE +  LR
Sbjct: 44  SANVAVDGQIVNLGLWDTAGQEDYSRLR 71


>At3g07410.1 68416.m00883 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 217

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 35/121 (28%), Positives = 59/121 (48%), Gaps = 3/121 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF+    AT+GVE    LV    +     +  T   +
Sbjct: 13  FKIVLIGDSAVGKSNLLSRFSRDEFDTNSKATIGVEFQTQLVEIEGKEVKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   V  T   ++      +++D+T   T+++V  W ++L   C+  +  +L GNK D++
Sbjct: 73  RFRAV--TSAYYRGAFGALIVYDITRGDTFESVKRWLQELNTHCDTAVAQMLVGNKCDLE 130

Query: 464 D 466
           D
Sbjct: 131 D 131


>At1g75840.1 68414.m08809 Rac-like GTP-binding protein (ARAC5) /
           Rho-like GTP-binding protein (ROP4) identical to
           RAC-like GTP-binding protein (ARAC5) SP:Q38937
           [Arabidopsis thaliana], Rho-like GTP binding protein
           [Arabidopsis thaliana] GI:2654009; identical to cDNA
           Rho-like GTP binding protein (Rop4) GI:2654008
          Length = 196

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 36/122 (29%), Positives = 55/122 (45%), Gaps = 3/122 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V        +     Q D 
Sbjct: 8   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDY 67

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
             L  L        +V  + F + S+ +Y+NV   W  +L     G+PI+L G K+D++D
Sbjct: 68  NRLRPLSYRGA---DVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRD 124

Query: 467 RK 472
            K
Sbjct: 125 DK 126



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 44  SANVVVDGNTVNLGLWDTAGQEDYNRLR 71


>At1g28550.1 68414.m03513 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:303742 from (Pisum
           sativum)
          Length = 218

 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFH-TNRGQFVLMCGTQPDK 289
           FK VL GD G GK+  + R    +F     AT+GVE         ++     +  T   +
Sbjct: 14  FKVVLTGDSGVGKSNLLSRFTRNDFSHDSRATIGVEFATRSIQCDDKIVKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   +  T   ++  V +++ +DVT  VT++NV  W ++L       I I+L GNK D++
Sbjct: 74  RYRAI--TSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDHTDANIVIMLVGNKADLR 131


>At1g20090.1 68414.m02514 Rac-like GTP-binding protein (ARAC4) /
           Rho-like GTP-binding protein (ROP2) identical to
           SP:Q38919 RAC-like GTP binding protein ARAC4 (GTP
           binding protein ROP2) [Arabidopsis thaliana], Rho-like
           GTP binding protein [Arabidopsis thaliana] GI:2654009
          Length = 195

 Score = 50.0 bits (114), Expect = 2e-06
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 3/122 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATL--GVEVHPLVFHTNRGQFVLMCGTQPDK 289
           KCV VGDG  GKT  +  + +  F   YV T+      + +V        +     Q D 
Sbjct: 7   KCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDY 66

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
             L  L        +V  + F + S+ +Y+N+   W  +L     G+PI+L G K+D++D
Sbjct: 67  NRLRPLSYRGA---DVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLRD 123

Query: 467 RK 472
            K
Sbjct: 124 DK 125



 Score = 28.7 bits (61), Expect = 4.5
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLR 309
           S+++  +   +   +WDTAGQE +  LR
Sbjct: 43  SANVVVDGNTVNLGLWDTAGQEDYNRLR 70


>At5g47960.1 68418.m05925 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 223

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 3/119 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF  +  AT+GVE        +R      +  T   +
Sbjct: 16  FKVVLIGDSAVGKSQLLARFSRNEFSIESKATIGVEFQTRTLEIDRKTIKAQIWDTAGQE 75

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           R   V  T   ++  V   +++D+T R ++ +V  W  +L     + I I+L GNK D+
Sbjct: 76  RYRAV--TSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKTDL 132


>At1g22740.1 68414.m02841 Ras-related protein (RAB7) / AtRab75 /
           small GTP-binding protein, putative identical to
           SP:O04157 Ras-related protein Rab7 (AtRab75)
           [Arabidopsis thaliana]
          Length = 203

 Score = 49.6 bits (113), Expect = 2e-06
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 5/120 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + +++  +F ++Y AT+G +        +     L       +  
Sbjct: 10  KVIILGDSGVGKTSLMNQYVNNKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLV-----RVCEGIPIVLCGNKVDI 460
              L        +   +++DV    +++++ NWH + +     R     P +L GNKVDI
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVNHLKSFESLDNWHNEFLTRASPRDPMAFPFILLGNKVDI 129


>At3g46830.1 68416.m05083 Ras-related protein (RAB11A) / small
           GTP-binding protein, putative identical to SP|Q96283
           Ras-related protein Rab11A {Arabidopsis thaliana};
           identical to cDNA Rab11 protein GI:2598228
          Length = 217

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 3/119 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD G GK+  + R    EF  +  +T+GVE                +  T   +
Sbjct: 13  FKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTTQVEGKTIKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           R   +  T   ++  V +++ +D+T R T+ NV  W R+L       I I++ GNK D+
Sbjct: 73  RYRAI--TSAYYRGAVGALLVYDITKRQTFDNVLRWLRELRDHADSNIVIMMAGNKSDL 129


>At1g49300.1 68414.m05526 Ras-related GTP-binding protein, putative
           contains Pfam profile: PF00071 Ras family
          Length = 206

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 5/120 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + +++  +F  +Y AT+G +            F L       +  
Sbjct: 10  KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNKVDI 460
              L        +   +++DV S  +++++ NW  + L++      E  P V+ GNK+D+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVNSAKSFEDLNNWREEFLIQASPSDPENFPFVVIGNKIDV 129



 Score = 36.7 bits (81), Expect = 0.017
 Identities = 14/44 (31%), Positives = 21/44 (47%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    +  + +E R     +WDTAGQE+F  L   +Y    C +
Sbjct: 42  GADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCV 85


>At1g01200.1 68414.m00034 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GB:D12541 GI:303736 from
           [Pisum sativum]
          Length = 237

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 4/120 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV--LMCGTQPD 286
           FK V++GD   GKT  + R    EF     +T+GVE       T RG+ V   +  T   
Sbjct: 29  FKVVVIGDSAVGKTQLLSRFTHNEFCYDSKSTIGVEFQTRTI-TLRGKLVKAQIWDTAGQ 87

Query: 287 KRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           +R   V  T   ++  +   V++D+T R+++ +V  W  +L     +   I+L GNK D+
Sbjct: 88  ERYRAV--TSAYYRGALGAMVVYDITKRLSFDHVARWVEELRAHADDSAVIMLVGNKADL 145


>At2g33870.1 68415.m04158 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:303742 from [Pisum
           sativum]
          Length = 219

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 43/136 (31%), Positives = 63/136 (46%), Gaps = 10/136 (7%)
 Frame = +2

Query: 83  TTKMADDMP-TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF 259
           T K  DD    FK VL GD G GK+  + R    +F     +T+GVE     F T RG  
Sbjct: 3   TYKAEDDYDYLFKVVLTGDSGVGKSNLLSRFTRNDFSHDSRSTIGVE-----FATRRGIQ 57

Query: 260 V-------LMCGTQPDKRSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VR 412
           V        +  T   +R   +  T   ++  V +++ +DVT  VT++NV  W ++L   
Sbjct: 58  VDDKIVKAQIWDTAGQERYRAI--TSAYYRGAVGALLVYDVTRHVTFENVERWLKELRDH 115

Query: 413 VCEGIPIVLCGNKVDI 460
                 I+L GNK D+
Sbjct: 116 TDANTVIMLVGNKADL 131


>At1g02130.1 68414.m00139 Ras-related protein (ARA-5) / small
           GTP-binding protein, putative identical to Ras-related
           protein ARA-5 SP:P28188 from [Arabidopsis thaliana]
          Length = 203

 Score = 48.8 bits (111), Expect = 4e-06
 Identities = 26/121 (21%), Positives = 55/121 (45%), Gaps = 1/121 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK+  + R     + + Y++T+GV+        +     L       + 
Sbjct: 9   FKLLLIGDSGVGKSCLLLRFSDDSYVESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDR 469
               + +      + + +++DVT   ++ NV  W  ++ R   + +  +L GNK D+ + 
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDVTDEESFNNVKQWLSEIDRYASDNVNKLLVGNKSDLTEN 128

Query: 470 K 472
           +
Sbjct: 129 R 129


>At5g47520.1 68418.m05867 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein RAB11J GI:1370160 from
           [Lotus japonicus]
          Length = 221

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 3/121 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF     +T+GVE        N  +    +  T   +
Sbjct: 15  FKIVLIGDSAVGKSNLLARFARDEFYPNSKSTIGVEFQTQKMDINGKEIKAQIWDTAGQE 74

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   V  T   ++  V +++ +D++ R T+ ++  W  +L    +  +  +L GNK D+K
Sbjct: 75  RFRAV--TSAYYRGAVGALLVYDISRRQTFHSIGRWLNELHTHSDMNVVTILVGNKSDLK 132

Query: 464 D 466
           D
Sbjct: 133 D 133


>At1g05810.1 68414.m00608 Ras-related protein (ARA-1) (ARA) / small
           GTP-binding protein, putative nearly identical to
           SP:P19892 Ras-related protein ARA-1 [Arabidopsis
           thaliana] (Gene 76:313-319(1989))
          Length = 261

 Score = 48.0 bits (109), Expect = 7e-06
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 3/121 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK V++GD   GK+  + R+   EF     AT+GVE           +    +  T   +
Sbjct: 56  FKIVVIGDSAVGKSNLLSRYARNEFSANSKATIGVEFQTQSMEIEGKEVKAQIWDTAGQE 115

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   V  T   ++  V   V++D+T R T+++V  W  +L +     +  +L GNK D++
Sbjct: 116 RFRAV--TSAYYRGAVGALVVYDITRRTTFESVGRWLDELKIHSDTTVARMLVGNKCDLE 173

Query: 464 D 466
           +
Sbjct: 174 N 174


>At5g03520.1 68418.m00308 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:871508 from [Pisum
           sativum]
          Length = 216

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 25/120 (20%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R     F   ++ T+G++        +  +  L       +  
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIKLQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT   ++ N+ NW +++ +   + +  +L GNK D+ + K
Sbjct: 77  FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDNVNKILVGNKADMDESK 136



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           ++  + + I+  +WDTAGQE+F  +   YY
Sbjct: 56  TVELDGKRIKLQIWDTAGQERFRTITTAYY 85


>At3g09900.1 68416.m01180 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:871510 from [Pisum
           sativum]; contains Pfam profile: PF00071 Ras family
          Length = 218

 Score = 47.6 bits (108), Expect = 9e-06
 Identities = 25/120 (20%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +L+GD G GK+  + R     F   ++ T+G++        +  +  L       +  
Sbjct: 17  KLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIKLQIWDTAGQER 76

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKDRK 472
              + T        + +++DVT   ++ N+ NW +++ +   + +  +L GNK D+ + K
Sbjct: 77  FRTITTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDSVNKILVGNKADMDESK 136



 Score = 33.1 bits (72), Expect = 0.21
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           ++  + + I+  +WDTAGQE+F  +   YY
Sbjct: 56  TVELDGKRIKLQIWDTAGQERFRTITTAYY 85


>At3g12160.1 68416.m01516 Ras-related GTP-binding family protein
           similar to ras-related GTP-binding protein RGP1
           SP:P25766 from [Oryza sativa];contains Pfam profile:
           PF00071 Ras family
          Length = 222

 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 3/119 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           FK VL+GD   GKT  + R    EF     AT+GVE     +   N+     +  T   +
Sbjct: 16  FKVVLIGDSAVGKTQLLARFARNEFSVDSKATIGVEFQTKTLVIDNKTVKAQIWDTAGQE 75

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDI 460
           R   V  T   ++  V   +++D+T R ++ ++  W  +L     + I I+L GNK D+
Sbjct: 76  RYRAV--TSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL 132


>At1g52280.1 68414.m05899 Ras-related GTP-binding protein, putative
           similar to RAB7D GI:1370187 from [Lotus japonicus]
           (Plant J. 11 (2), 237-250 (1997)); contains Pfam
           PF00071: Ras family
          Length = 206

 Score = 46.4 bits (105), Expect = 2e-05
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 5/124 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + + +  +F  +Y AT+G +        +   F L       +  
Sbjct: 10  KVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNKVDI 460
              L        +   +++DV    ++ N+ NW  + L++      E  P V+ GNK D+
Sbjct: 70  FQSLGVAFYRGADCCVLVYDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKTDV 129

Query: 461 KDRK 472
              K
Sbjct: 130 DGGK 133


>At3g16100.1 68416.m02034 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 206

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 5/129 (3%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + + +  +F  +Y AT+G +        +   F L       +  
Sbjct: 10  KVIILGDSGVGKTSLMNQFVNRKFSNQYKATIGADFLTKEVQIDDRIFTLQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRD-LVRVC----EGIPIVLCGNKVDI 460
              L        +   ++ DV    +++N+ NW  + L++      E  P V+ GNK D+
Sbjct: 70  FQSLGVAFYRGADCCVLVNDVNVMKSFENLNNWREEFLIQASPSDPENFPFVVLGNKTDV 129

Query: 461 KDRKVKAKT 487
              K +  T
Sbjct: 130 DGGKSRVVT 138


>At4g17160.1 68417.m02582 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:1208537 from [Glycine
           max]
          Length = 205

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 27/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE        +     L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLKFTDKRFQAVHDLTIGVEFGAKTITIDNKPIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKD 466
           S   + T + ++    +++ +D+T R T+ ++ +W  +      E +  +L GNK D++D
Sbjct: 67  SFRSV-TRSYYRGRAGTLLVYDITRRETFNHLASWLEEARQHASENMTTMLIGNKCDLED 125

Query: 467 RK 472
           ++
Sbjct: 126 KR 127



 Score = 36.3 bits (80), Expect = 0.022
 Identities = 39/151 (25%), Positives = 66/151 (43%), Gaps = 10/151 (6%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRR-----NLSS 369
           G    + +I  + + I+  +WDTAGQE F  +   YY    G   +  + R     +L+S
Sbjct: 40  GVEFGAKTITIDNKPIKLQIWDTAGQESFRSVTRSYYRGRAGTLLVYDITRRETFNHLAS 99

Query: 370 YVQKCT*LA*RFGPCM*RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYN 549
           ++++    A      M     C +  +    R  S  E   F +E  L + + SAK+ +N
Sbjct: 100 WLEEARQHASENMTTMLIGNKCDLEDK----RTVSTEEGEQFAREHGLIFMEASAKTAHN 155

Query: 550 FEKPFLWLAR---KLIGDGNLEFVAMPALLP 633
            E+ F+  A    K I DG ++    P + P
Sbjct: 156 VEEAFVETAATIYKRIQDGVVDEANEPGITP 186


>At4g09720.1 68417.m01596 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein RAB7A from [Lotus
           japonicus]
          Length = 206

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 24/120 (20%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K +++GD G GKT+ + +++  +F  +Y AT+G +              L       +  
Sbjct: 10  KVIVLGDSGVGKTSLMNQYVHKKFSMQYKATIGADFVTKELQIGEKLVTLQIWDTAGQER 69

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-----EGIPIVLCGNKVDI 460
              L        +  ++++DV    ++ N+  WH + ++       +  P ++ GNK+D+
Sbjct: 70  FQSLGAAFYRGADCCALVYDVNVLRSFDNLETWHEEFLKQASPSDPKTFPFIVLGNKIDV 129


>At3g11730.1 68416.m01439 Ras-related GTP-binding protein, putative
           similar to Rab1-like small GTP-binding protein
           GI:4096662 from [Petunia x hybrida]
          Length = 205

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 1/122 (0%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD   GK+  + R     +   Y++T+GV+        +     L       + 
Sbjct: 9   FKLLLIGDSSVGKSCLLLRFADDAYIDSYISTIGVDFKIRTIEQDGKTIKLQIWDTAGQE 68

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVC-EGIPIVLCGNKVDIKDR 469
               + +      + + +++D T   ++ NV  W  ++ R   E +  +L GNK D+ + 
Sbjct: 69  RFRTITSSYYRGAHGIIIVYDCTEMESFNNVKQWLSEIDRYANESVCKLLIGNKNDMVES 128

Query: 470 KV 475
           KV
Sbjct: 129 KV 130



 Score = 34.3 bits (75), Expect = 0.091
 Identities = 12/30 (40%), Positives = 19/30 (63%)
 Frame = +1

Query: 232 SIPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           +I  + + I+  +WDTAGQE+F  +   YY
Sbjct: 49  TIEQDGKTIKLQIWDTAGQERFRTITSSYY 78


>At1g18200.1 68414.m02264 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 354

 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 34/126 (26%), Positives = 63/126 (50%), Gaps = 4/126 (3%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF      T+GV+  +  V   ++     +  T   +
Sbjct: 14  FKAVLIGDSAVGKSNLLSRFSRDEFRLDSKPTIGVDFAYRNVRVGDKTIKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDI- 460
           R   +  T + ++  + +++ +D+T R+T+KN+  W  +L         +VL GNK D+ 
Sbjct: 74  RFRAI--TSSYYRGALGALLIYDITRRITFKNIEKWLSELRGFSSPETVVVLVGNKSDLG 131

Query: 461 KDRKVK 478
           + R+V+
Sbjct: 132 QSREVE 137



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 9/136 (6%)
 Frame = +1

Query: 187 REKIRCDS----GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISH 348
           R++ R DS    G      ++    + I+  +WDTAGQE+F  +   YY    G   I  
Sbjct: 35  RDEFRLDSKPTIGVDFAYRNVRVGDKTIKAQIWDTAGQERFRAITSSYYRGALGALLIYD 94

Query: 349 VRRNLS-SYVQKCT*LA*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQY 519
           + R ++   ++K   L+   G         LV  +S  G  R+    E     + + L +
Sbjct: 95  ITRRITFKNIEKW--LSELRGFSSPETVVVLVGNKSDLGQSREVEEEEGKTLAESEGLYF 152

Query: 520 YDISAKSNYNFEKPFL 567
            + SA  N N E+ FL
Sbjct: 153 LETSALENQNVEEAFL 168


>At2g44690.1 68415.m05562 Rac-like GTP-binding protein (ARAC9)
           identical to rac-like protein ARAC9 GI:5381419 from
           [Arabidopsis thaliana]
          Length = 209

 Score = 44.8 bits (101), Expect = 6e-05
 Identities = 35/129 (27%), Positives = 55/129 (42%), Gaps = 1/129 (0%)
 Frame = +2

Query: 83  TTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFV 262
           +T  A      KCV VGDG  GKT  +  + +  F   YV T+    +  V    +   +
Sbjct: 9   STSSATATTFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFNANVLVDGKTVNL 68

Query: 263 LMCGTQPDKRSLVVLETDTIFKDNVLSVMFDVTSRVTYKNV-PNWHRDLVRVCEGIPIVL 439
            +  T   +    V        D V  + F + SR +++N+   W  +L      +PIVL
Sbjct: 69  GLWDTAGQEDYNRVRPLSYRGAD-VFILAFSLISRPSFENIAKKWVPELRHYAPTVPIVL 127

Query: 440 CGNKVDIKD 466
            G K D++D
Sbjct: 128 VGTKSDLRD 136


>At2g43130.1 68415.m05356 Ras-related protein (ARA-4) / small
           GTP-binding protein, putative identical to SP:P28187
           Ras-related protein ARA-4 {Arabidopsis thaliana}
          Length = 214

 Score = 44.4 bits (100), Expect = 8e-05
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVH-PLVFHTNRGQFVLMCGTQPDK 289
           FK V++GD   GK+  + R+   EF     AT+GVE     +    +     +  T   +
Sbjct: 13  FKIVIIGDSAVGKSNLLTRYARNEFNPNSKATIGVEFQTQSMLIDGKEVKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIK 463
           R   V  T   ++  V   V++D+T   T++NV  W  +L       +  +L GNK D++
Sbjct: 73  RFRAV--TSAYYRGAVGALVVYDITRSSTFENVGRWLDELNTHSDTTVAKMLIGNKCDLE 130


>At2g31680.1 68415.m03867 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:289370 from [Brassica
           napus]
          Length = 219

 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 3/120 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQF-VLMCGTQPDK 289
           FK V++GD   GK+  + R+   EF     AT+GVE           +    +  T   +
Sbjct: 13  FKIVIIGDSAVGKSNLLSRYARNEFNAHSKATIGVEFQTQNMEIEGKEVKAQIWDTAGQE 72

Query: 290 RSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   V  T   ++  V   V++D++ R T+++V  W  +L    +  +  +L GNK D++
Sbjct: 73  RFRAV--TSAYYRGAVGALVVYDISRRSTFESVGRWLDELKTHSDTTVARMLVGNKCDLE 130


>At4g17170.1 68417.m02583 Rab2-like GTP-binding protein (RAB2)
           identical to Rab2-like protein (At-RAB2) GI:1765896 from
           [Arabidopsis thaliana]
          Length = 211

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 2/122 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +     L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDNKPIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           S   + T + ++    +++ +D+T R T+ ++ +W  D  +     + I+L GNK D+  
Sbjct: 67  SFRSI-TRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANANMTIMLIGNKCDLAH 125

Query: 467 RK 472
           R+
Sbjct: 126 RR 127



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY 321
           I  + + I+  +WDTAGQE F  +   YY
Sbjct: 48  ITIDNKPIKLQIWDTAGQESFRSITRSYY 76


>At1g73640.1 68414.m08525 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 ras family Pfam profile:
           PF00071 Ras family
          Length = 233

 Score = 43.2 bits (97), Expect = 2e-04
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 3/123 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHT-NRGQFVLMCGTQPDK 289
           FK VL+GD   GK+  + R    EF      T+GVE      H  ++     +  T   +
Sbjct: 14  FKAVLIGDSAVGKSNLLSRFSKDEFRFDSKPTIGVEFAYRNVHVGDKIIKAQIWDTAGQE 73

Query: 290 RSLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIK 463
           R   +  T + ++  + +++ +D+T R T+ N+  W  +L         +VL GNK D++
Sbjct: 74  RFRAI--TSSYYRGALGALLIYDITRRTTFDNIKKWLFELRDFANPETVVVLVGNKSDLR 131

Query: 464 DRK 472
             +
Sbjct: 132 QSR 134


>At4g35860.1 68417.m05093 Ras-related GTP-binding protein, putative
           similar to Rab2-like GTP-binding protein GI:1765896 from
           [Arabidopsis thaliana]
          Length = 211

 Score = 42.7 bits (96), Expect = 3e-04
 Identities = 28/126 (22%), Positives = 60/126 (47%), Gaps = 2/126 (1%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +++GD G GK+  + +     F+  +  T+GVE    +   +     L       + 
Sbjct: 7   FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTVDGRPIKLQIWDTAGQE 66

Query: 293 SLVVLETDTIFKDNVLSVM-FDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
           S   + T + ++    +++ +D+T R T+ ++ +W  D  +     + I+L GNK D+  
Sbjct: 67  SFRSI-TRSYYRGAAGALLVYDITRRETFNHLASWLEDARQHANPNMSIMLIGNKCDLAH 125

Query: 467 RKVKAK 484
           ++  +K
Sbjct: 126 KRAVSK 131



 Score = 33.9 bits (74), Expect = 0.12
 Identities = 33/127 (25%), Positives = 57/127 (44%), Gaps = 9/127 (7%)
 Frame = +1

Query: 235 IPYEPRAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRR-----NLSSYVQKCT*L 393
           +  + R I+  +WDTAGQE F  +   YY    G   +  + R     +L+S+++     
Sbjct: 48  VTVDGRPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASWLEDARQH 107

Query: 394 A*RFGPCM*RYPYCLVRKQS--GY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFL 567
           A    P M      L+  +    + R  S  E   F +E  L + + SA++  N E+ F+
Sbjct: 108 A---NPNM---SIMLIGNKCDLAHKRAVSKEEGQQFAKEHGLLFLEASARTAQNVEEAFI 161

Query: 568 WLARKLI 588
             A K++
Sbjct: 162 ETAAKIL 168


>At5g45130.1 68418.m05540 Ras-related protein (RHA1) / small
           GTP-binding protein identical to Ras-related protein
           RHA1 SP:P31582 from [Arabidopsis thaliana]
          Length = 200

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 2/125 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VL+GD G GK++ V R +  +F +   +T+G          N             +  
Sbjct: 12  KLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQER 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKD-R 469
              L            ++FD+T++ +++    W ++L  +    + + L GNK D+ D R
Sbjct: 72  YHSLAPMYYRGAAAAIIVFDITNQASFERAKKWVQELQAQGNPNMVMALAGNKADLLDAR 131

Query: 470 KVKAK 484
           KV A+
Sbjct: 132 KVSAE 136



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    S ++      ++F +WDTAGQE++  L   YY     AI
Sbjct: 44  GAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAI 87


>At5g54840.1 68418.m06830 GTP-binding family protein similar to
           SP|P87027 Septum-promoting GTP-binding protein 1 (GTPase
           spg1)(Sid3 protein) {Schizosaccharomyces pombe}
          Length = 288

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 3/122 (2%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN--RGQFVLMCG 274
           D+ + K  L+GD  TGKTTFV +++ G+  + ++   G+ +    F+       F +   
Sbjct: 98  DLVSLKISLLGDCQTGKTTFVVKYV-GDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDV 156

Query: 275 TQPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNK 451
              +KRS          KD V +  MFD+TSR T  +V  W+    +  +    +L G K
Sbjct: 157 GGDEKRSKD--HIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILIGTK 214

Query: 452 VD 457
            D
Sbjct: 215 FD 216


>At4g19640.1 68417.m02884 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein RAB5A GI:1370178 from
           [Lotus japonicus]
          Length = 200

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 2/125 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKRS 295
           K VL+GD G GK++ V R +  +F +   +T+G          N             +  
Sbjct: 12  KLVLLGDVGAGKSSLVLRFVKDQFVEFQESTIGAAFFSQTLAVNDATVKFEIWDTAGQER 71

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDL-VRVCEGIPIVLCGNKVDIKD-R 469
              L            ++FDVT++ +++    W ++L  +    + + L GNK D+ D R
Sbjct: 72  YHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDAR 131

Query: 470 KVKAK 484
           KV A+
Sbjct: 132 KVTAE 136



 Score = 35.5 bits (78), Expect = 0.039
 Identities = 15/44 (34%), Positives = 22/44 (50%)
 Frame = +1

Query: 211 GCRSTSSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           G    S ++      ++F +WDTAGQE++  L   YY     AI
Sbjct: 44  GAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAI 87


>At3g54840.1 68416.m06076 Rab GTPase (ARA6) identical to small
           GTPase Ara6 [Arabidopsis thaliana] GI:13160603
          Length = 202

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 30/122 (24%), Positives = 54/122 (44%), Gaps = 3/122 (2%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV--HPLVFHTNRGQFVLMCGTQPDK 289
           K VL+GD G GK+  V R + G+F+     T+G       +    +      +  T   +
Sbjct: 35  KLVLLGDSGVGKSCIVLRFVRGQFDATSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQE 94

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVR-VCEGIPIVLCGNKVDIKD 466
           R    L         V  +++D+TS  ++K    W ++L +     I + L GNK D+ +
Sbjct: 95  R-YSALAPLYYRGAGVAVIVYDITSPESFKKAQYWVKELQKHGSPDIVMALVGNKADLHE 153

Query: 467 RK 472
           ++
Sbjct: 154 KR 155



 Score = 33.5 bits (73), Expect = 0.16
 Identities = 11/22 (50%), Positives = 16/22 (72%)
 Frame = +1

Query: 256 IRFNVWDTAGQEKFGGLRDGYY 321
           ++F +WDTAGQE++  L   YY
Sbjct: 83  VKFEIWDTAGQERYSALAPLYY 104


>At3g21700.2 68416.m02735 expressed protein
          Length = 248

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 43/146 (29%), Positives = 71/146 (48%), Gaps = 8/146 (5%)
 Frame = +2

Query: 44  SIFLYNHE*NSHKTTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV 223
           S  +Y+++ NSH+ +    D+ + K  L+GD   GKT+F+ +++ GE EK+      VE+
Sbjct: 87  SSVVYDND-NSHRRSD--SDLVSLKISLLGDPEIGKTSFLAKYV-GE-EKE------VEM 135

Query: 224 HPLVFHTNRGQFVLMCGTQPDKRSLVVLETD-------TIFKDNV-LSVMFDVTSRVTYK 379
             L    N     L  G      S+  LE +          KD+V +  MFD+TSR T  
Sbjct: 136 RELEKGINCTDKTLYMGGARISYSIWELEAERSRDQIPVACKDSVAILFMFDLTSRCTLN 195

Query: 380 NVPNWHRDLVRVCEGIPIVLCGNKVD 457
           +V +W++   +  +    V+ G K D
Sbjct: 196 SVISWYQQARKSNQTAIPVMVGTKFD 221


>At3g21700.1 68416.m02736 expressed protein
          Length = 291

 Score = 38.7 bits (86), Expect = 0.004
 Identities = 43/146 (29%), Positives = 71/146 (48%), Gaps = 8/146 (5%)
 Frame = +2

Query: 44  SIFLYNHE*NSHKTTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV 223
           S  +Y+++ NSH+ +    D+ + K  L+GD   GKT+F+ +++ GE EK+      VE+
Sbjct: 87  SSVVYDND-NSHRRSD--SDLVSLKISLLGDPEIGKTSFLAKYV-GE-EKE------VEM 135

Query: 224 HPLVFHTNRGQFVLMCGTQPDKRSLVVLETD-------TIFKDNV-LSVMFDVTSRVTYK 379
             L    N     L  G      S+  LE +          KD+V +  MFD+TSR T  
Sbjct: 136 RELEKGINCTDKTLYMGGARISYSIWELEAERSRDQIPVACKDSVAILFMFDLTSRCTLN 195

Query: 380 NVPNWHRDLVRVCEGIPIVLCGNKVD 457
           +V +W++   +  +    V+ G K D
Sbjct: 196 SVISWYQQARKSNQTAIPVMVGTKFD 221


>At5g10260.1 68418.m01191 Ras-related GTP-binding protein, putative
           similar to Ras-related protein Rab-6A SP:P20340 from
           [Homo sapiens]
          Length = 178

 Score = 38.3 bits (85), Expect = 0.006
 Identities = 27/100 (27%), Positives = 53/100 (53%), Gaps = 3/100 (3%)
 Frame = +2

Query: 182 EFEKKYVATLGVE-VHPLVFHTNRGQFVLMCGTQPDKRSLVVLETDTIFKDNVLSVMFDV 358
           +F+  Y AT+G++ +   ++  +R   + +  T   +R   ++ +  I   +V  +++DV
Sbjct: 4   KFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPS-YIRDSSVAVIVYDV 62

Query: 359 TSRVTYKNVPNWHRDLVRVCEG--IPIVLCGNKVDIKDRK 472
            +R ++ N   W  D VR   G  + IVL GNK D+ D++
Sbjct: 63  ANRQSFLNTSKWIED-VRTERGSDVIIVLVGNKTDLVDKR 101



 Score = 35.1 bits (77), Expect = 0.052
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +1

Query: 226 SSSIPYEPRAIRFNVWDTAGQEKFGGLRDGYYIQGQCAI 342
           S ++  E R +R  +WDTAGQE+F  L   Y      A+
Sbjct: 19  SKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAV 57


>At5g54840.2 68418.m06831 GTP-binding family protein similar to
           SP|P87027 Septum-promoting GTP-binding protein 1 (GTPase
           spg1)(Sid3 protein) {Schizosaccharomyces pombe}
          Length = 215

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 3/102 (2%)
 Frame = +2

Query: 101 DMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN--RGQFVLMCG 274
           D+ + K  L+GD  TGKTTFV +++ G+  + ++   G+ +    F+       F +   
Sbjct: 98  DLVSLKISLLGDCQTGKTTFVVKYV-GDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDV 156

Query: 275 TQPDKRSLVVLETDTIFKDNV-LSVMFDVTSRVTYKNVPNWH 397
              +KRS          KD V +  MFD+TSR T  +V  W+
Sbjct: 157 GGDEKRSKD--HIPIACKDAVAILFMFDLTSRSTLNSVFGWY 196


>At3g09910.1 68416.m01181 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein GI:2723477 from
           [Arabidopsis thaliana] ;contains Pfam profile: PF00071
           Ras family
          Length = 205

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 30/126 (23%), Positives = 56/126 (44%), Gaps = 4/126 (3%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           +FK +L+GD G GK++ +   ++   E     T+GV+           +  L       +
Sbjct: 13  SFKILLIGDSGVGKSSLLLSFISSSVE-DLAPTIGVDFKIKQMKVRGKRLKLTIWDTAGQ 71

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIV--LCGNKVDI 460
                L +        + +++DVT R T+ N+ + W +++         +  L GNKVD 
Sbjct: 72  EKFRTLTSSYFRGSQGIILVYDVTKRETFLNLADIWAKEIELYSTNHDCIKMLVGNKVDR 131

Query: 461 K-DRKV 475
           + +RKV
Sbjct: 132 ESERKV 137



 Score = 32.3 bits (70), Expect = 0.37
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY 321
           + ++  +WDTAGQEKF  L   Y+
Sbjct: 59  KRLKLTIWDTAGQEKFRTLTSSYF 82


>At1g43890.1 68414.m05059 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein(RAB1Y) GI:1370173 from
           (Lotus japonicus)
          Length = 212

 Score = 37.5 bits (83), Expect = 0.010
 Identities = 30/127 (23%), Positives = 55/127 (43%), Gaps = 3/127 (2%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           FK +L+GD G GK++ +    +  F+     T+GV+           +  L       + 
Sbjct: 14  FKVLLIGDSGVGKSSLLLSFTSNTFD-DLSPTIGVDFKVKYLTIGEKKLKLAIWDTAGQE 72

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHR--DLVRVCEGIPIVLCGNKVDIK 463
               L +        + +++DVT R T+ N+ + W +  DL    +    +L GNKVD +
Sbjct: 73  RFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDIWAKEIDLYSTNQDCIKMLVGNKVDKE 132

Query: 464 DRKVKAK 484
             +  +K
Sbjct: 133 SERAVSK 139



 Score = 35.9 bits (79), Expect = 0.030
 Identities = 37/120 (30%), Positives = 52/120 (43%), Gaps = 7/120 (5%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY--IQGQCAISHVRR-----NLSSYVQKCT*LA*RFG 408
           + ++  +WDTAGQE+F  L   YY   QG   +  V R     NLS    K   L     
Sbjct: 59  KKLKLAIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDIWAKEIDLYSTNQ 118

Query: 409 PCM*RYPYCLVRKQSGY*RQKS*GENYCFPQEKDLQYYDISAKSNYNFEKPFLWLARKLI 588
            C+       V K+S   R  S  E   F +E    + + SAK+  N E+ F  L  K++
Sbjct: 119 DCIKMLVGNKVDKESE--RAVSKKEGIDFAREYGCLFLECSAKTRVNVEQCFEELVLKIL 176


>At3g21700.3 68416.m02737 expressed protein
          Length = 292

 Score = 37.1 bits (82), Expect = 0.013
 Identities = 45/147 (30%), Positives = 72/147 (48%), Gaps = 9/147 (6%)
 Frame = +2

Query: 44  SIFLYNHE*NSHKTTKMADDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEV 223
           S  +Y+++ NSH+ +    D+ + K  L+GD   GKT+F+ +++ GE EK+      VE+
Sbjct: 87  SSVVYDND-NSHRRSD--SDLVSLKISLLGDPEIGKTSFLAKYV-GE-EKE------VEM 135

Query: 224 HPLVFHTNRGQFVLMCGTQPDKRSLVVLE-----TDTI---FKDNV-LSVMFDVTSRVTY 376
             L    N     L  G      S+  LE      D I    KD+V +  MFD+TSR T 
Sbjct: 136 RELEKGINCTDKTLYMGGARISYSIWELEGAERSRDQIPVACKDSVAILFMFDLTSRCTL 195

Query: 377 KNVPNWHRDLVRVCEGIPIVLCGNKVD 457
            +V +W++   +  +    V+ G K D
Sbjct: 196 NSVISWYQQARKSNQTAIPVMVGTKFD 222


>At5g46025.1 68418.m05660 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 113

 Score = 35.9 bits (79), Expect = 0.030
 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = +2

Query: 344 VMFDVTSRVTYKNVPNWHRDLVRV--CEGIPIVLCGNKVDIKDRK 472
           +++D+TS  T+KNV  W ++L      + + I+L GNK D+  R+
Sbjct: 22  IVYDITSHTTFKNVEQWLKELRGFFDTDKLMIMLVGNKSDLDHRR 66


>At5g65960.1 68418.m08303 expressed protein
          Length = 393

 Score = 35.1 bits (77), Expect = 0.052
 Identities = 36/117 (30%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTN-RGQFVLMCGTQ-PDKRS 295
           ++VG  G GK T + R L+ EFE    ++   EVH    +T      V +C +   D+ S
Sbjct: 8   LVVGSSGVGKRTLLSRLLSVEFEDSSESSSQTEVHGWTINTKYYTADVSVCISHICDEYS 67

Query: 296 LVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNW--HRDLVRVCEGIPIVLC-GNKVD 457
           L  L          L ++FD++   T   + +W  H D+        I+LC GNKVD
Sbjct: 68  LPNLPNSHPLV--ALVMVFDLSELSTLVALQDWVSHTDI----NSFDILLCIGNKVD 118


>At5g27540.1 68418.m03297 GTP-binding protein-related low similarity
           to Mig-2-like GTPase Mtl [Drosophila melanogaster]
           GI:7271872; contains Pfam profile PF00036: EF hand
          Length = 648

 Score = 34.7 bits (76), Expect = 0.069
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 2/119 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLM-CGTQPDKR 292
           + V+VGD GTGK++ +    T  F       L     P+ F  +     ++   ++P+ R
Sbjct: 19  RIVVVGDKGTGKSSLIVAAATDSFPPNVPPVLPDYKLPIEFFPDGIPVTIVDTSSRPEDR 78

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPN-WHRDLVRVCEGIPIVLCGNKVDIKD 466
            +V  E   + + + + + +      T + +   W  +L R+   IPI++ G K+D +D
Sbjct: 79  DIVAEE---LKRADAVVLTYACDRPETLERLSEYWLPELRRLEVKIPIIVAGCKLDFRD 134


>At5g03530.1 68418.m00309 Ras-related GTP-binding family protein
           contains Pfam profile: PF00071 Ras family
          Length = 210

 Score = 34.3 bits (75), Expect = 0.091
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 3/119 (2%)
 Frame = +2

Query: 110 TFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDK 289
           +FK +L+GD G GK++ +   ++   E     T+GV+           +  L       +
Sbjct: 13  SFKILLIGDSGVGKSSLLVSFISSSVE-DLAPTIGVDFKIKQLTVGGKRLKLTIWDTAGQ 71

Query: 290 RSLVVLETDTIFKDNVLSVMFDVTSRVTYKN-VPNWHR--DLVRVCEGIPIVLCGNKVD 457
                L +        + +++DVT R T+ N V  W +  +L    +    +L GNKVD
Sbjct: 72  ERFRTLTSSYYRGAQGIILVYDVTRRETFTNLVDVWGKEIELYSTNQECVRMLVGNKVD 130



 Score = 32.7 bits (71), Expect = 0.28
 Identities = 11/24 (45%), Positives = 16/24 (66%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYY 321
           + ++  +WDTAGQE+F  L   YY
Sbjct: 59  KRLKLTIWDTAGQERFRTLTSSYY 82


>At4g09720.2 68417.m01597 Ras-related GTP-binding protein, putative
           similar to GTP-binding protein RAB7A from [Lotus
           japonicus]
          Length = 172

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = +1

Query: 250 RAIRFNVWDTAGQEKFGGLRDGYYIQGQC 336
           + +   +WDTAGQE+F  L   +Y    C
Sbjct: 21  KLVTLQIWDTAGQERFQSLGAAFYRGADC 49



 Score = 27.9 bits (59), Expect = 7.9
 Identities = 10/45 (22%), Positives = 25/45 (55%), Gaps = 5/45 (11%)
 Frame = +2

Query: 341 SVMFDVTSRVTYKNVPNWHRDLVRVC-----EGIPIVLCGNKVDI 460
           ++++DV    ++ N+  WH + ++       +  P ++ GNK+D+
Sbjct: 51  ALVYDVNVLRSFDNLETWHEEFLKQASPSDPKTFPFIVLGNKIDV 95


>At1g02440.1 68414.m00192 ADP-ribosylation factor, putative similar
           to ADP-ribosylation factor GB:AAA32729 GI:166586 from
           (Arabidopsis thaliana)
          Length = 190

 Score = 31.5 bits (68), Expect = 0.64
 Identities = 18/55 (32%), Positives = 29/55 (52%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQ 280
           + VL G GGTGK++ + +  TGE     + T+G+ V  + +  +   F  M G Q
Sbjct: 19  RIVLFGLGGTGKSSIMHKFKTGETLTTTMPTVGLNVESVKYKDSNLCFWEMGGQQ 73


>At1g22040.1 68414.m02757 kelch repeat-containing F-box family
           protein contains Pfam profiles PF01344: Kelch motif,
           PF00646: F-box domain
          Length = 475

 Score = 31.1 bits (67), Expect = 0.85
 Identities = 14/46 (30%), Positives = 24/46 (52%)
 Frame = -1

Query: 387 GTFLYVTREVTSNMTDSTLSLNIVSVSKTTKLLLSGCVPHIKTNCP 250
           G   ++TR+   N+T     +  + VS ++    S  +PH+KTN P
Sbjct: 401 GKLHFITRDPNHNVTVLRADVPNIPVSSSSSSSSSVSIPHLKTNAP 446


>At3g13640.1 68416.m01718 RNase L inhibitor protein, putative
           similar to 68 kDa protein HP68 GI:16755057 from
           [Triticum aestivum]
          Length = 603

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 13/25 (52%), Positives = 19/25 (76%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKK 196
           V++G+ GTGKTTF+ R L G F ++
Sbjct: 378 VMLGENGTGKTTFI-RMLAGAFPRE 401


>At3g05310.1 68416.m00579 GTP-binding protein-related low similarity
           to rac 1 protein [Physcomitrella patens] GI:7243743;
           contains Pfam profile PF00036: EF hand (domain)
          Length = 648

 Score = 29.9 bits (64), Expect = 2.0
 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 2/119 (1%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNR-GQFVLMCGTQPDKR 292
           + V+VG+ G+GK++ +       F     + L     P  F  +R    V+   ++P+ +
Sbjct: 16  RIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDK 75

Query: 293 SLVVLETDTIFKDNVLSVMFDVTSRVTYKNVPNWHRDLVRVCE-GIPIVLCGNKVDIKD 466
             VV E   + + + + + F      T   +  +   L R  E  +PI++ G +VD K+
Sbjct: 76  GKVVKE---VRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLEVRVPIIVAGYEVDNKE 131


>At5g37150.1 68418.m04460 tRNA-splicing endonuclease positive
           effector-related contains similarity to SEN1, a positive
           effector of tRNA-splicing endonuclease [Saccharomyces
           cerevisiae] gi|172574|gb|AAB63976
          Length = 839

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 32/104 (30%), Positives = 46/104 (44%), Gaps = 6/104 (5%)
 Frame = -1

Query: 414 TRTKSLCQLGTFLYVTREVTSNMTDSTLSLNIVSVSKTTKLLLSGCVPHIKT-NCP---- 250
           T TKS+ Q  T   V   V   M D TL L+I+  +K         +  ++T NC     
Sbjct: 186 TLTKSVLQANTVNNVF--VLKMMGDLTLFLDIIRSTKLNSSQEDAILGCLETRNCTHKNS 243

Query: 249 -RFVWNTRGCTSTPRVATYFFSNSPVKCLLTKVVLPVPPSPTNT 121
            + +W   G   T  VAT  F+   ++C   K V+    +PTNT
Sbjct: 244 VKLIWGPPGTGKTKTVATLLFALLKLRC---KTVV---CAPTNT 281


>At4g30300.1 68417.m04306 ABC transporter family protein
           ribonuclease L inhibitor - Mus musculus,PIR2:JC6555
          Length = 181

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 16/37 (43%), Positives = 23/37 (62%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPL 232
           V++G+ GTGKTTF+K  L G   K  +   G +VH +
Sbjct: 24  VMLGENGTGKTTFIKM-LAG--SKLDIDEEGSQVHEI 57


>At4g21800.2 68417.m03154 ATP-binding family protein contains Pfam
           domain, PF03029: Conserved hypothetical ATP binding
           protein
          Length = 379

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKK---YVATLGVEVHPLVFHTN 247
           ++VG  G+GKT+F+ R +   F+ K   YV  L   V  L F  N
Sbjct: 45  IVVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGAN 89


>At4g21800.1 68417.m03153 ATP-binding family protein contains Pfam
           domain, PF03029: Conserved hypothetical ATP binding
           protein
          Length = 379

 Score = 29.1 bits (62), Expect = 3.4
 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 3/45 (6%)
 Frame = +2

Query: 122 VLVGDGGTGKTTFVKRHLTGEFEKK---YVATLGVEVHPLVFHTN 247
           ++VG  G+GKT+F+ R +   F+ K   YV  L   V  L F  N
Sbjct: 45  IVVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGAN 89


>At5g44110.1 68418.m05397 ABC transporter family protein
          Length = 282

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 5/32 (15%)
 Frame = +2

Query: 101 DMPT-FKCVLVGDGGTGKTTFVK----RHLTG 181
           D+P   +C+LVG  G+GKTT +K    +H+ G
Sbjct: 35  DLPAGSRCLLVGANGSGKTTLLKILAGKHMVG 66


>At5g32405.1 68418.m03813 hypothetical protein
          Length = 256

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 17/50 (34%), Positives = 26/50 (52%)
 Frame = -1

Query: 234 TRGCTSTPRVATYFFSNSPVKCLLTKVVLPVPPSPTNTHLNVGISSAIFV 85
           TR   STPR + + F+  P+  L+T     VPPS  +T  ++    A F+
Sbjct: 82  TRSPHSTPRSSAFTFTARPLLDLITLPRGRVPPSHRSTAYSMTSFRAFFI 131


>At1g03905.1 68414.m00375 ABC transporter family protein similar to
           NBD-like protein GB:AAD20643
          Length = 290

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 5/32 (15%)
 Frame = +2

Query: 101 DMPT-FKCVLVGDGGTGKTTFVK----RHLTG 181
           D+P   +C+LVG  G+GKTT +K    +H+ G
Sbjct: 36  DLPAGSRCLLVGANGSGKTTLLKILAGKHMVG 67


>At2g15310.1 68415.m01746 ADP-ribosylation factor, putative similar
           to ADP-ribosylation factor (GI:861205) [Chlamydomonas
           reinhardtii]
          Length = 205

 Score = 28.3 bits (60), Expect = 6.0
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = +1

Query: 244 EPRAIRFNVWDTAGQEKFGGLRDGYYIQGQ 333
           E + I F VWD  GQEK   L   Y+   Q
Sbjct: 57  EYKGINFTVWDIGGQEKIRKLWRHYFQNAQ 86


>At5g02270.1 68418.m00150 ABC transporter family protein NBD-like
           protein POP, Arabidopsis thaliana, EMBL:AF127664
          Length = 328

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 10/17 (58%), Positives = 13/17 (76%)
 Frame = +2

Query: 116 KCVLVGDGGTGKTTFVK 166
           +C+LVG  G GKTT +K
Sbjct: 50  RCLLVGSNGAGKTTILK 66


>At1g03160.1 68414.m00293 GTP-binding protein-related contains
           TIGRFAM TIGR00650: GTP-binding conserved hypothetical
           protein domain; contains TIGRFAM TIGR00231: small
           GTP-binding protein domain; similar to  mitofusin 1
           precursor (GI:12744896) [Homo sapiens]
          Length = 642

 Score = 27.9 bits (59), Expect = 7.9
 Identities = 23/97 (23%), Positives = 42/97 (43%), Gaps = 5/97 (5%)
 Frame = +2

Query: 113 FKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGQFVLMCGTQPDKR 292
           F  V+VG+  +GK+T +   L   + K+ V     E+  L +     +    C T PD +
Sbjct: 350 FLMVIVGEFNSGKSTVINALLGKRYLKEGVVPTTNEITFLCYSDLESEEQQRCQTHPDGQ 409

Query: 293 SLVVLETDTIFKDNVL-----SVMFDVTSRVTYKNVP 388
            +  L    +   N++     +V+     R+T + VP
Sbjct: 410 YVCYLPAPILKDINIVDTPGTNVILQRQQRLTEEFVP 446


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,406,041
Number of Sequences: 28952
Number of extensions: 409972
Number of successful extensions: 1461
Number of sequences better than 10.0: 95
Number of HSP's better than 10.0 without gapping: 1264
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1378
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1721869952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -