SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS20001
         (745 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3 (HS...   190   6e-49
At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70...   183   1e-46
At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)...   174   4e-44
At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)...   174   4e-44
At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)...   174   4e-44
At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)...   169   2e-42
At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70...   120   1e-27
At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1 (HS...   118   5e-27
At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2 (HS...   118   5e-27
At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta...   118   5e-27
At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70...   117   9e-27
At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)...   112   3e-25
At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)...   103   1e-22
At1g79930.1 68414.m09340 heat shock protein, putative contains P...    74   9e-14
At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial, p...    73   2e-13
At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70...    73   3e-13
At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70...    73   3e-13
At1g11660.1 68414.m01339 heat shock protein, putative strong sim...    63   2e-10
At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70...    49   3e-06
At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id...    38   0.007
At2g32120.2 68415.m03926 heat shock protein 70 family protein / ...    38   0.007
At2g32120.1 68415.m03925 heat shock protein 70 family protein / ...    38   0.007
At5g62550.1 68418.m07850 expressed protein                             31   1.1  
At4g24910.1 68417.m03566 hypothetical protein contains Pfam prof...    29   2.5  
At3g63200.1 68416.m07100 patatin-related low similarity to patat...    29   4.3  
At2g27350.5 68415.m03295 OTU-like cysteine protease family prote...    29   4.3  
At2g27350.4 68415.m03294 OTU-like cysteine protease family prote...    29   4.3  
At2g27350.3 68415.m03293 OTU-like cysteine protease family prote...    29   4.3  
At2g27350.2 68415.m03292 OTU-like cysteine protease family prote...    29   4.3  
At2g27350.1 68415.m03291 OTU-like cysteine protease family prote...    29   4.3  
At4g27630.2 68417.m03972 expressed protein                             28   5.7  
At4g34940.1 68417.m04953 armadillo/beta-catenin repeat family pr...    28   7.5  
At3g11180.1 68416.m01357 oxidoreductase, 2OG-Fe(II) oxygenase fa...    28   7.5  
At4g18375.2 68417.m02727 KH domain-containing protein contains s...    27   9.9  
At4g18375.1 68417.m02726 KH domain-containing protein contains s...    27   9.9  
At1g68330.1 68414.m07805 expressed protein                             27   9.9  

>At3g09440.1 68416.m01121 heat shock cognate 70 kDa protein 3
           (HSC70-3) (HSP70-3) identical to SP|O65719 Heat shock
           cognate 70 kDa protein 3 (Hsc70.3) {Arabidopsis
           thaliana}
          Length = 649

 Score =  190 bits (464), Expect = 6e-49
 Identities = 113/207 (54%), Positives = 132/207 (63%), Gaps = 10/207 (4%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 P-TTQYSMPNV------SSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS 416
           P  T +    +       S V S + L   T  +G +   ++  N +       + K FS
Sbjct: 66  PINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKG------EDKEFS 119

Query: 417 PRKSVPWCXXXXXXXXXXILANCAE-CSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
             +                L    +       AYFNDSQRQATKDAG I+GLNV+RIINE
Sbjct: 120 AEEISSMILIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINE 179

Query: 594 PTAAAIAYGLDKKGT--GERNVLIFDL 668
           PTAAAIAYGLDKK T  GE+NVLIFDL
Sbjct: 180 PTAAAIAYGLDKKATSVGEKNVLIFDL 206



 Score =  100 bits (239), Expect = 1e-21
 Identities = 48/76 (63%), Positives = 59/76 (77%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGG-KPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F D++VQ+D+K WPF + S    KP I V YKGEDK F  EE+S
Sbjct: 65  NPINTVFDAKRLIGRRFTDSSVQSDIKLWPFTLKSGPAEKPMIVVNYKGEDKEFSAEEIS 124

Query: 431 SMVLTKMKETAEAYLG 478
           SM+L KM+E AEAYLG
Sbjct: 125 SMILIKMREIAEAYLG 140



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 208 GGTFDVSLLTIEEGIFEVKATAGDT 232


>At1g16030.1 68414.m01924 heat shock protein 70, putative / HSP70,
           putative similar to heat shock protein hsp70 GI:1771478
           from [Pisum sativum]
          Length = 646

 Score =  183 bits (446), Expect = 1e-46
 Identities = 113/208 (54%), Positives = 129/208 (62%), Gaps = 14/208 (6%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT 266
           A+GIDLGTTYSCVGV+ + +VEII NDQGNRTTPSYVAFTDTERLIGDAAKNQVA+ P  
Sbjct: 8   AIGIDLGTTYSCVGVWMNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQN 67

Query: 267 -----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPF 413
                      ++S P+V SD+       K     G   + V+          + + K F
Sbjct: 68  TVFDAKRLIGRKFSDPSVQSDILHWPF--KVVSGPGEKPMIVVS--------YKNEEKQF 117

Query: 414 SPRKSVPWCXXXXXXXXXXILANCAE-CSYHGSAYFNDSQRQATKDAGTISGLNVLRIIN 590
           SP +                L    +       AYFNDSQRQATKDAG ISGLNVLRIIN
Sbjct: 118 SPEEISSMVLVKMKEVAEAFLGRTVKNAVVTVPAYFNDSQRQATKDAGAISGLNVLRIIN 177

Query: 591 EPTAAAIAYGLDKKGT--GERNVLIFDL 668
           EPTAAAIAYGLDKKGT  GE+NVLIFDL
Sbjct: 178 EPTAAAIAYGLDKKGTKAGEKNVLIFDL 205



 Score =  112 bits (270), Expect = 2e-25
 Identities = 52/77 (67%), Positives = 63/77 (81%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGRKF D +VQ+D+ HWPF+VVS  G KP I V+YK E+K F PEE+S
Sbjct: 64  NPQNTVFDAKRLIGRKFSDPSVQSDILHWPFKVVSGPGEKPMIVVSYKNEEKQFSPEEIS 123

Query: 431 SMVLTKMKETAEAYLGK 481
           SMVL KMKE AEA+LG+
Sbjct: 124 SMVLVKMKEVAEAFLGR 140



 Score = 50.4 bits (115), Expect = 1e-06
 Identities = 21/25 (84%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+G+FEVK+TAGDT
Sbjct: 207 GGTFDVSLLTIEEGVFEVKATAGDT 231


>At5g42020.2 68418.m05116 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 613

 Score =  174 bits (424), Expect = 4e-44
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A+ P  +
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP--E 95

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK---TKPFSPRKSVPWC 440
            ++ +V   +  K    +      L    ++  + +    +++K   TK FSP +     
Sbjct: 96  RTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMI 155

Query: 441 XXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L     +      AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAY
Sbjct: 156 LTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAY 215

Query: 618 GLDKKGTGERNVLIFDL 668
           GLDKKG GE+N+L+FDL
Sbjct: 216 GLDKKG-GEKNILVFDL 231



 Score =  102 bits (245), Expect = 2e-22
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P  T+FD KRLIGRKFED  VQ D K  P+++V+  GKP I+V  K GE K F PEE+S
Sbjct: 93  NPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEIS 152

Query: 431 SMVLTKMKETAEAYLGK 481
           +M+LTKMKETAEAYLGK
Sbjct: 153 AMILTKMKETAEAYLGK 169



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 19/25 (76%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV ST GDT
Sbjct: 233 GGTFDVSVLTIDNGVFEVLSTNGDT 257


>At5g42020.1 68418.m05115 luminal binding protein 2 (BiP-2) (BP2)
           similar to SWISS-PROT: Q39043; GI:1303695; luminal
           binding protein (BiP) [Arabidopsis thaliana]
          Length = 668

 Score =  174 bits (424), Expect = 4e-44
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A+ P  +
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP--E 95

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK---TKPFSPRKSVPWC 440
            ++ +V   +  K    +      L    ++  + +    +++K   TK FSP +     
Sbjct: 96  RTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMI 155

Query: 441 XXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L     +      AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAY
Sbjct: 156 LTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAY 215

Query: 618 GLDKKGTGERNVLIFDL 668
           GLDKKG GE+N+L+FDL
Sbjct: 216 GLDKKG-GEKNILVFDL 231



 Score =  102 bits (245), Expect = 2e-22
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P  T+FD KRLIGRKFED  VQ D K  P+++V+  GKP I+V  K GE K F PEE+S
Sbjct: 93  NPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEIS 152

Query: 431 SMVLTKMKETAEAYLGK 481
           +M+LTKMKETAEAYLGK
Sbjct: 153 AMILTKMKETAEAYLGK 169



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 19/25 (76%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV ST GDT
Sbjct: 233 GGTFDVSVLTIDNGVFEVLSTNGDT 257


>At5g28540.1 68418.m03480 luminal binding protein 1 (BiP-1) (BP1)
           SWISS-PROT:Q9LKR3 PMID:8888624
          Length = 669

 Score =  174 bits (424), Expect = 4e-44
 Identities = 99/197 (50%), Positives = 127/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTTYSCVGV+++G VEIIANDQGNR TPS+V FTD+ERLIG+AAKNQ A+ P  +
Sbjct: 38  IGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERLIGEAAKNQAAVNP--E 95

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVK---TKPFSPRKSVPWC 440
            ++ +V   +  K    +      L    ++  + +    +++K   TK FSP +     
Sbjct: 96  RTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEISAMI 155

Query: 441 XXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAY 617
                      L     +      AYFND+QRQATKDAG I+GLNV RIINEPTAAAIAY
Sbjct: 156 LTKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAY 215

Query: 618 GLDKKGTGERNVLIFDL 668
           GLDKKG GE+N+L+FDL
Sbjct: 216 GLDKKG-GEKNILVFDL 231



 Score =  102 bits (245), Expect = 2e-22
 Identities = 49/77 (63%), Positives = 59/77 (76%), Gaps = 1/77 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYK-GEDKTFFPEEVS 430
           +P  T+FD KRLIGRKFED  VQ D K  P+++V+  GKP I+V  K GE K F PEE+S
Sbjct: 93  NPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGKPYIQVKIKDGETKVFSPEEIS 152

Query: 431 SMVLTKMKETAEAYLGK 481
           +M+LTKMKETAEAYLGK
Sbjct: 153 AMILTKMKETAEAYLGK 169



 Score = 45.2 bits (102), Expect = 5e-05
 Identities = 19/25 (76%), Positives = 23/25 (92%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTI++G+FEV ST GDT
Sbjct: 233 GGTFDVSVLTIDNGVFEVLSTNGDT 257


>At1g09080.1 68414.m01013 luminal binding protein 3 (BiP-3) (BP3)
           Similar to Arabidopsis luminal binding protein
           (gb|D89342); contains Pfam domain PF00012: dnaK protein
          Length = 678

 Score =  169 bits (411), Expect = 2e-42
 Identities = 101/198 (51%), Positives = 119/198 (60%), Gaps = 5/198 (2%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           +GIDLGTTYSCVGV+ +  VEIIANDQGNR TPS+VAFTDTERLIG+AAKNQ A  P   
Sbjct: 53  IGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAAKNPERT 112

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKP----FSPRKSVPW 437
              P     +  K     P     +  L     N   + +I+VK K     FSP +    
Sbjct: 113 IFDP--KRLIGRK--FDDPDVQRDIKFLPYKVVNKDGKPYIQVKVKGEEKLFSPEEISAM 168

Query: 438 CXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIA 614
                       L     +      AYFND+QRQATKDAG I+GLNV+RIINEPT AAIA
Sbjct: 169 ILTKMKETAEAFLGKKIKDAVITVPAYFNDAQRQATKDAGAIAGLNVVRIINEPTGAAIA 228

Query: 615 YGLDKKGTGERNVLIFDL 668
           YGLDKKG GE N+L++DL
Sbjct: 229 YGLDKKG-GESNILVYDL 245



 Score =  107 bits (256), Expect = 1e-23
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P  TIFD KRLIGRKF+D  VQ D+K  P++VV+  GKP I+V  KGE+K F PEE+S+
Sbjct: 108 NPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVKGEEKLFSPEEISA 167

Query: 434 MVLTKMKETAEAYLGK 481
           M+LTKMKETAEA+LGK
Sbjct: 168 MILTKMKETAEAFLGK 183



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 20/25 (80%), Positives = 24/25 (96%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSILTI++G+FEV ST+GDT
Sbjct: 247 GGTFDVSILTIDNGVFEVLSTSGDT 271


>At3g12580.1 68416.m01567 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein
           GI:425194 [Spinacia oleracea]
          Length = 650

 Score =  120 bits (288), Expect = 1e-27
 Identities = 54/62 (87%), Positives = 59/62 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 PT 263
           PT
Sbjct: 66  PT 67



 Score =  104 bits (250), Expect = 5e-23
 Identities = 49/76 (64%), Positives = 60/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR++ D +VQAD  HWPF+VVS  G KP I V +KGE+K F  EE+S
Sbjct: 65  NPTNTVFDAKRLIGRRYSDPSVQADKSHWPFKVVSGPGEKPMIVVNHKGEEKQFSAEEIS 124

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEA+LG
Sbjct: 125 SMVLIKMREIAEAFLG 140



 Score = 97.5 bits (232), Expect = 8e-21
 Identities = 48/55 (87%), Positives = 51/55 (92%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFNDSQRQATKDAG ISGLNV+RIINEPTAAAIAYGLDKK +  GE+NVLIFDL
Sbjct: 152 AYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDL 206



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 208 GGTFDVSLLTIEEGIFEVKATAGDT 232


>At5g02500.1 68418.m00183 heat shock cognate 70 kDa protein 1
           (HSC70-1) (HSP70-1) identical to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}
          Length = 651

 Score =  118 bits (283), Expect = 5e-27
 Identities = 53/61 (86%), Positives = 58/61 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 P 260
           P
Sbjct: 66  P 66



 Score =  102 bits (245), Expect = 2e-22
 Identities = 48/76 (63%), Positives = 59/76 (77%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEV-VSDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F D++VQ+DMK WPF++      KP I V YKGE+K F  EE+S
Sbjct: 65  NPVNTVFDAKRLIGRRFSDSSVQSDMKLWPFKIQAGPADKPMIYVEYKGEEKEFAAEEIS 124

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEAYLG
Sbjct: 125 SMVLIKMREIAEAYLG 140



 Score = 97.9 bits (233), Expect = 6e-21
 Identities = 48/55 (87%), Positives = 51/55 (92%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNV+RIINEPTAAAIAYGLDKK T  GE+NVLIFDL
Sbjct: 152 AYFNDSQRQATKDAGVIAGLNVMRIINEPTAAAIAYGLDKKATSVGEKNVLIFDL 206



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 208 GGTFDVSLLTIEEGIFEVKATAGDT 232


>At5g02490.1 68418.m00182 heat shock cognate 70 kDa protein 2
           (HSC70-2) (HSP70-2) identical to SP|P22954 Heat shock
           cognate 70 kDa protein 2 (Hsc70.2) {Arabidopsis
           thaliana}
          Length = 653

 Score =  118 bits (283), Expect = 5e-27
 Identities = 53/61 (86%), Positives = 58/61 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 P 260
           P
Sbjct: 66  P 66



 Score =   99 bits (238), Expect = 2e-21
 Identities = 47/76 (61%), Positives = 59/76 (77%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVS-DGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F DA+VQ+D + WPF ++S    KP I V YKGE+K F  EE+S
Sbjct: 65  NPVNTVFDAKRLIGRRFSDASVQSDRQLWPFTIISGTAEKPMIVVEYKGEEKQFAAEEIS 124

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEA+LG
Sbjct: 125 SMVLIKMREIAEAFLG 140



 Score = 98.7 bits (235), Expect = 4e-21
 Identities = 49/55 (89%), Positives = 51/55 (92%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK T  GE+NVLIFDL
Sbjct: 152 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGEKNVLIFDL 206



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 208 GGTFDVSLLTIEEGIFEVKATAGDT 232


>At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein,
           putative / HSC70, putative / HSP70, putative strong
           similarity to heat shock cognate 70 kd protein 1
           SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)]
          Length = 617

 Score =  118 bits (283), Expect = 5e-27
 Identities = 53/61 (86%), Positives = 58/61 (95%)
 Frame = +3

Query: 78  KAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMT 257
           + PA+GIDLGTTYSCVGV+QH +VEIIANDQGNRTTPSYVAFTD+ERLIGDAAKNQVAM 
Sbjct: 6   EGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKNQVAMN 65

Query: 258 P 260
           P
Sbjct: 66  P 66



 Score =  104 bits (250), Expect = 5e-23
 Identities = 50/76 (65%), Positives = 59/76 (77%), Gaps = 1/76 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P NT+FDAKRLIGR+F DA+VQ+DMK WPF+V      KP I V YKGE+K F  EE+S
Sbjct: 65  NPVNTVFDAKRLIGRRFSDASVQSDMKFWPFKVTPGQADKPMIFVNYKGEEKQFAAEEIS 124

Query: 431 SMVLTKMKETAEAYLG 478
           SMVL KM+E AEAYLG
Sbjct: 125 SMVLIKMREIAEAYLG 140



 Score = 95.5 bits (227), Expect = 3e-20
 Identities = 48/55 (87%), Positives = 50/55 (90%), Gaps = 2/55 (3%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGT--GERNVLIFDL 668
           AYFNDSQRQATKDAG I+GLNVLRIINEPTAAAIAYGLDKK T  G +NVLIFDL
Sbjct: 152 AYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKKATSVGIKNVLIFDL 206



 Score = 50.8 bits (116), Expect = 9e-07
 Identities = 22/25 (88%), Positives = 25/25 (100%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+LTIE+GIFEVK+TAGDT
Sbjct: 208 GGTFDVSLLTIEEGIFEVKATAGDT 232


>At4g24280.1 68417.m03486 heat shock protein 70, putative / HSP70,
           putative strong similarity to heat shock protein 70
           [Arabidopsis thaliana] GI:6746592; similar to heat shock
           70 protein - Spinacia oleracea,PID:g2654208
          Length = 718

 Score =  117 bits (281), Expect = 9e-27
 Identities = 77/202 (38%), Positives = 103/202 (50%), Gaps = 2/202 (0%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 245
           ++     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + +RL+G  AK Q
Sbjct: 74  RVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSGDRLVGQIAKRQ 133

Query: 246 VAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK 425
             + P   +   +V   +  KM       S  +S   V + N   +       K F+  +
Sbjct: 134 AVVNPENTFF--SVKRFIGRKMNEVDEE-SKQVSYRVVRDENNNVKLECPAINKQFAAEE 190

Query: 426 -SVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
            S              +     +      AYFNDSQR ATKDAG I+GL VLRIINEPTA
Sbjct: 191 ISAQVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTA 250

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           A++AYG D+K      +L+FDL
Sbjct: 251 ASLAYGFDRK--ANETILVFDL 270



 Score = 57.2 bits (132), Expect = 1e-08
 Identities = 54/170 (31%), Positives = 79/170 (46%), Gaps = 6/170 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT F  KR IGRK  +  V  + K   + VV D     +K+     +K F  EE+S+
Sbjct: 137 NPENTFFSVKRFIGRKMNE--VDEESKQVSYRVVRDENN-NVKLECPAINKQFAAEEISA 193

Query: 434 MVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCC 604
            VL K+ + A  +L  K+ +  ++         +T+ K       LE  R  N       
Sbjct: 194 QVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEVLRIINE------ 247

Query: 605 CDCLRS*QKGYWR--TKCTYL*PRGG-TFDVSILTIEDGIFEVKSTAGDT 745
                S   G+ R   +   +   GG TFDVS+L + DG+FEV ST+GDT
Sbjct: 248 -PTAASLAYGFDRKANETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDT 296


>At5g49910.1 68418.m06180 heat shock protein 70 / HSP70 (HSC70-7)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746592
          Length = 718

 Score =  112 bits (269), Expect = 3e-25
 Identities = 74/202 (36%), Positives = 103/202 (50%), Gaps = 2/202 (0%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQ 245
           ++     VGIDLGTT S V   + GK  I+ N +G RTTPS VA+T + +RL+G  AK Q
Sbjct: 74  RVVNEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTKSKDRLVGQIAKRQ 133

Query: 246 VAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK 425
             + P   +   +V   +  +M       S  +S   + + N   +       K F+  +
Sbjct: 134 AVVNPENTFF--SVKRFIGRRMNEVAEE-SKQVSYRVIKDENGNVKLDCPAIGKQFAAEE 190

Query: 426 -SVPWCXXXXXXXXXXILANCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
            S              +     +      AYFNDSQR ATKDAG I+GL VLRIINEPTA
Sbjct: 191 ISAQVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTA 250

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           A++AYG ++K      +L+FDL
Sbjct: 251 ASLAYGFERK--SNETILVFDL 270



 Score = 54.0 bits (124), Expect = 1e-07
 Identities = 52/170 (30%), Positives = 78/170 (45%), Gaps = 6/170 (3%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT F  KR IGR+  +  V  + K   + V+ D     +K+      K F  EE+S+
Sbjct: 137 NPENTFFSVKRFIGRRMNE--VAEESKQVSYRVIKD-ENGNVKLDCPAIGKQFAAEEISA 193

Query: 434 MVLTKMKETAEAYLG-KLCRMQLSRFRVLQ*LSKTSHKRCRYHLWLE--RSPNHQ*TDCC 604
            VL K+ + A  +L  K+ +  ++         +T+ K       LE  R  N       
Sbjct: 194 QVLRKLVDDASRFLNDKVTKAVITVPAYFNDSQRTATKDAGRIAGLEVLRIINE------ 247

Query: 605 CDCLRS*QKGYWR--TKCTYL*PRGG-TFDVSILTIEDGIFEVKSTAGDT 745
                S   G+ R   +   +   GG TFDVS+L + DG+FEV ST+GDT
Sbjct: 248 -PTAASLAYGFERKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDT 296


>At5g09590.1 68418.m01110 heat shock protein 70 / HSP70 (HSC70-5)
           identical to heat shock protein 70 [Arabidopsis
           thaliana] GI:6746590
          Length = 682

 Score =  103 bits (247), Expect = 1e-22
 Identities = 73/202 (36%), Positives = 101/202 (50%), Gaps = 2/202 (0%)
 Frame = +3

Query: 69  KMAKAPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAF-TDTERLIGDAAKNQ 245
           K A    +GIDLGTT SCV V +    ++I N +G RTTPS VAF T  E L+G  AK Q
Sbjct: 53  KPAGNDVIGIDLGTTNSCVAVMEGKNPKVIENAEGARTTPSVVAFNTKGELLVGTPAKRQ 112

Query: 246 VAMTPTTQYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFSPRK 425
               PT   ++      +  K    +      +    ++ A       +    + +SP +
Sbjct: 113 AVTNPTN--TVSGTKRLIGRKFDDPQTQKEMKMVPYKIVRAPNGDA-WVEANGQQYSPSQ 169

Query: 426 SVPWCXXXXXXXXXXILA-NCAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTA 602
              +            L  +  +      AYFND+QRQATKDAG I+GL+V RIINEPTA
Sbjct: 170 IGAFILTKMKETAEAYLGKSVTKAVVTVPAYFNDAQRQATKDAGRIAGLDVERIINEPTA 229

Query: 603 AAIAYGLDKKGTGERNVLIFDL 668
           AA++YG+  K   E  + +FDL
Sbjct: 230 AALSYGMTNK---EGLIAVFDL 248



 Score = 68.9 bits (161), Expect = 3e-12
 Identities = 33/76 (43%), Positives = 47/76 (61%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NT+   KRLIGRKF+D   Q +MK  P+++V     P      +   + + P ++ +
Sbjct: 116 NPTNTVSGTKRLIGRKFDDPQTQKEMKMVPYKIVR---APNGDAWVEANGQQYSPSQIGA 172

Query: 434 MVLTKMKETAEAYLGK 481
            +LTKMKETAEAYLGK
Sbjct: 173 FILTKMKETAEAYLGK 188



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 18/25 (72%), Positives = 22/25 (88%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVS+L I +G+FEVK+T GDT
Sbjct: 250 GGTFDVSVLEISNGVFEVKATNGDT 274


>At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam
           profile: PF00012 Heat shock hsp70 proteins; similar to
           heat-shock proteins GB:CAA94389, GB:AAD55461
           [Arabidopsis thaliana]
          Length = 831

 Score = 74.1 bits (174), Expect = 9e-14
 Identities = 58/201 (28%), Positives = 86/201 (42%), Gaps = 12/201 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT- 266
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 267 ----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS 416
                     Q+S P +  D+ S         + G     ++ AN         + + F+
Sbjct: 64  ISQIKRLIGRQFSDPELQRDIKSLPFSV----TEGPDGYPLIHANYLG------EKRAFT 113

Query: 417 PRKSVPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P + +              L     +C      YF D QR+A  DA TI+GL+ LR+I+E
Sbjct: 114 PTQVMGMMLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLRLIHE 173

Query: 594 PTAAAIAYGLDKKGTGERNVL 656
            TA A+AYG+ K    E + L
Sbjct: 174 TTATALAYGIYKTDLPESDQL 194



 Score = 60.9 bits (141), Expect = 9e-10
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P N+I   KRLIGR+F D  +Q D+K  PF V     G P I   Y GE + F P +V 
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEKRAFTPTQVM 118

Query: 431 SMVLTKMKETAEAYL 475
            M+L+ +K  AE  L
Sbjct: 119 GMMLSNLKGIAEKNL 133


>At4g37910.1 68417.m05361 heat shock protein 70, mitochondrial,
           putative / HSP70, mitochondrial, putative strong
           similarity to SP|Q01899 Heat shock 70 kDa protein,
           mitochondrial precursor {Phaseolus vulgaris}
          Length = 682

 Score = 72.9 bits (171), Expect = 2e-13
 Identities = 36/76 (47%), Positives = 49/76 (64%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSS 433
           +P NTIF +KRLIGR+F+D   Q +MK  P+++V     P      +   + F P ++ +
Sbjct: 111 NPTNTIFGSKRLIGRRFDDPQTQKEMKMVPYKIVK---APNGDAWVEANGQKFSPSQIGA 167

Query: 434 MVLTKMKETAEAYLGK 481
            VLTKMKETAEAYLGK
Sbjct: 168 NVLTKMKETAEAYLGK 183



 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 35/53 (66%), Positives = 44/53 (83%)
 Frame = +3

Query: 510 AYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 668
           AYFND+QRQATKDAG I+GL+V RIINEPTAAA++YG++ K   E  + +FDL
Sbjct: 194 AYFNDAQRQATKDAGKIAGLDVQRIINEPTAAALSYGMNNK---EGVIAVFDL 243



 Score = 58.0 bits (134), Expect = 6e-09
 Identities = 29/59 (49%), Positives = 35/59 (59%), Gaps = 1/59 (1%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDT-ERLIGDAAKNQVAMTPT 263
           +GIDLGTT SCV V +     +I N +G+RTTPS VA     E L+G  AK Q    PT
Sbjct: 55  IGIDLGTTNSCVSVMEGKTARVIENAEGSRTTPSVVAMNQKGELLVGTPAKRQAVTNPT 113



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 19/25 (76%), Positives = 21/25 (84%)
 Frame = +2

Query: 671 GGTFDVSILTIEDGIFEVKSTAGDT 745
           GGTFDVSIL I  G+FEVK+T GDT
Sbjct: 245 GGTFDVSILEISSGVFEVKATNGDT 269


>At1g79920.2 68414.m09339 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 57/201 (28%), Positives = 85/201 (42%), Gaps = 12/201 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT- 266
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 267 ----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS 416
                     Q+S P +  D+ S         + G     ++ AN         + + F+
Sbjct: 64  ISQIKRLIGRQFSDPELQRDIKSLPFSV----TEGPDGYPLIHANYLG------EIRAFT 113

Query: 417 PRKSVPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P + +              L     +C      YF D QR+A  DA TI+GL+ L +I+E
Sbjct: 114 PTQVMGMMLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHE 173

Query: 594 PTAAAIAYGLDKKGTGERNVL 656
            TA A+AYG+ K    E + L
Sbjct: 174 TTATALAYGIYKTDLPENDQL 194



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P N+I   KRLIGR+F D  +Q D+K  PF V     G P I   Y GE + F P +V 
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVM 118

Query: 431 SMVLTKMKETAEAYL 475
            M+L+ +K  AE  L
Sbjct: 119 GMMLSNLKGIAEKNL 133


>At1g79920.1 68414.m09338 heat shock protein 70, putative / HSP70,
           putative contains Pfam profile: PF00012 Heat shock hsp70
           proteins; similar to heat-shock proteins GB:CAA94389,
           GB:AAD55461 [Arabidopsis thaliana]
          Length = 736

 Score = 72.5 bits (170), Expect = 3e-13
 Identities = 57/201 (28%), Positives = 85/201 (42%), Gaps = 12/201 (5%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTT- 266
           VG D G     V V +   ++++ ND+ NR TP+ V F D +R IG A      M P   
Sbjct: 4   VGFDFGNENCLVAVARQRGIDVVLNDESNRETPAIVCFGDKQRFIGTAGAASTMMNPKNS 63

Query: 267 ----------QYSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTKPFS 416
                     Q+S P +  D+ S         + G     ++ AN         + + F+
Sbjct: 64  ISQIKRLIGRQFSDPELQRDIKSLPFSV----TEGPDGYPLIHANYLG------EIRAFT 113

Query: 417 PRKSVPWCXXXXXXXXXXILANCA-ECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINE 593
           P + +              L     +C      YF D QR+A  DA TI+GL+ L +I+E
Sbjct: 114 PTQVMGMMLSNLKGIAEKNLNTAVVDCCIGIPVYFTDLQRRAVLDAATIAGLHPLHLIHE 173

Query: 594 PTAAAIAYGLDKKGTGERNVL 656
            TA A+AYG+ K    E + L
Sbjct: 174 TTATALAYGIYKTDLPENDQL 194



 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 32/75 (42%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +2

Query: 254 DPNNTIFDAKRLIGRKFEDATVQADMKHWPFEVV-SDGGKPKIKVAYKGEDKTFFPEEVS 430
           +P N+I   KRLIGR+F D  +Q D+K  PF V     G P I   Y GE + F P +V 
Sbjct: 59  NPKNSISQIKRLIGRQFSDPELQRDIKSLPFSVTEGPDGYPLIHANYLGEIRAFTPTQVM 118

Query: 431 SMVLTKMKETAEAYL 475
            M+L+ +K  AE  L
Sbjct: 119 GMMLSNLKGIAEKNL 133


>At1g11660.1 68414.m01339 heat shock protein, putative strong
           similarity to gb|Z70314 heat-shock protein from
           Arabidopsis thaliana and is a member of the PF|00012
           Hsp70 protein family
          Length = 773

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 51/187 (27%), Positives = 86/187 (45%), Gaps = 7/187 (3%)
 Frame = +3

Query: 90  VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQ 269
           VG D+G     + V +   ++++ ND+ NR  P+ V+F + +R +G AA     M P + 
Sbjct: 4   VGFDVGNENCVIAVAKQRGIDVLLNDESNRENPAMVSFGEKQRFMGAAAAASATMHPKST 63

Query: 270 YSMPNVSSDVSSKMLLCKPT*STGLSRLSVMEANLRSR*HIRVKTK------PFSPRKSV 431
            S   +   +  K    +P     L RL   E +  S   I+++ +       FSP + +
Sbjct: 64  IS--QLKRLIGRKFR--EPDVQNDL-RLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQIL 118

Query: 432 PWCXXXXXXXXXXILAN-CAECSYHGSAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA 608
                         L    ++C     +YF +SQR A  DA  I+GL  LR++++ TA A
Sbjct: 119 GMLLSHLKQIAEKSLKTPVSDCVIGIPSYFTNSQRLAYLDAAAIAGLRPLRLMHDSTATA 178

Query: 609 IAYGLDK 629
           + YG+ K
Sbjct: 179 LGYGIYK 185



 Score = 62.1 bits (144), Expect = 4e-10
 Identities = 31/74 (41%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDG-GKPKIKVAYKGEDKTFFPEEVSS 433
           P +TI   KRLIGRKF +  VQ D++ +PFE   D  G  +I++ Y GE ++F P ++  
Sbjct: 60  PKSTISQLKRLIGRKFREPDVQNDLRLFPFETSEDSDGGIQIRLRYMGEIQSFSPVQILG 119

Query: 434 MVLTKMKETAEAYL 475
           M+L+ +K+ AE  L
Sbjct: 120 MLLSHLKQIAEKSL 133


>At4g16660.1 68417.m02517 heat shock protein 70, putative / HSP70,
           putative
          Length = 867

 Score = 49.2 bits (112), Expect = 3e-06
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +3

Query: 513 YFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKK-GTGERNVLIFDLAA 674
           YF  ++R+    A  ++G+NVL ++NE + AA+ YG+DK    G R+V+ +D+ +
Sbjct: 172 YFGQAERRGLIQASQLAGVNVLSLVNEHSGAALQYGIDKDFANGSRHVIFYDMGS 226



 Score = 36.3 bits (80), Expect = 0.021
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 4/71 (5%)
 Frame = +3

Query: 75  AKAPAVGIDLGTTYSCVGV--FQHGK--VEIIANDQGNRTTPSYVAFTDTERLIGDAAKN 242
           +++  + +DLG+ +  V V   + G+  + +  N+   R +P+ VAF   +RL+G+ A  
Sbjct: 22  SESAVLSVDLGSEWVKVAVVNLKRGQSPISVAINEMSKRKSPALVAFQSGDRLLGEEAAG 81

Query: 243 QVAMTPTTQYS 275
             A  P   YS
Sbjct: 82  ITARYPNKVYS 92



 Score = 27.9 bits (59), Expect = 7.5
 Identities = 15/70 (21%), Positives = 30/70 (42%)
 Frame = +2

Query: 257 PNNTIFDAKRLIGRKFEDATVQADMKHWPFEVVSDGGKPKIKVAYKGEDKTFFPEEVSSM 436
           PN      + ++G+ F+      D  + PF++V D  +  + +        +  EE+ +M
Sbjct: 87  PNKVYSQLRDMVGKPFKHVKDFIDSVYLPFDIVED-SRGAVGIKIDDGSTVYSVEELLAM 145

Query: 437 VLTKMKETAE 466
           +L      AE
Sbjct: 146 ILGYASNLAE 155


>At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly
            identical to auxin transport protein; BIG [Arabidopsis
            thaliana] GI:21779966; contains Pfam profiles PF02207:
            Putative zinc finger in N-recognin, PF00569: Zinc finger
            ZZ type
          Length = 5098

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 24/66 (36%), Positives = 32/66 (48%)
 Frame = -3

Query: 626  VKTVSNRSSSRFIDDSENVQARDGTCIFCGLSLRVIEVRGTVITAFCTVCQDKLRQFPSF 447
            V T SNRS S+ +D  +  +  DG     GL    +++ G V+  F   C D LRQF  F
Sbjct: 3150 VVTGSNRSGSQSVDSKKKKKGEDGHD--SGLEKLYVDMEG-VVDIFSANCGDLLRQFIDF 3206

Query: 446  S*APWN 429
                WN
Sbjct: 3207 FLLEWN 3212


>At2g32120.2 68415.m03926 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPF--EVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           IF+ KRL+GR   D  V A  K+ PF  + +  G +P I        ++  PEEV ++ L
Sbjct: 93  IFNMKRLVGRVDTDPVVHAS-KNLPFLVQTLDIGVRPFIAALVNNAWRSTTPEEVLAIFL 151

Query: 443 TKMKETAEAYLGKLCR 490
            +++  AEA L +  R
Sbjct: 152 VELRLMAEAQLKRPVR 167



 Score = 34.3 bits (75), Expect = 0.087
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 209
           A+GID+GT+   + V+   +V I+ N +  +   S+V F D
Sbjct: 30  ALGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFKD 70



 Score = 31.5 bits (68), Expect = 0.61
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 8/61 (13%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLIFDLA 671
           F+  Q    + A  ++GL+VLR++ EPTA A+ Y         D  G+G ER  +IF++ 
Sbjct: 177 FSRFQLTRFERACAMAGLHVLRLMPEPTAIALLYAQQQQMTTHDNMGSGSERLAVIFNMG 236

Query: 672 A 674
           A
Sbjct: 237 A 237


>At2g32120.1 68415.m03925 heat shock protein 70 family protein /
           HSP70 family protein similar to SP|P22953 Heat shock
           cognate 70 kDa protein 1 (Hsc70.1) {Arabidopsis
           thaliana}; contains InterPro accession IPR001023: Heat
           shock protein Hsp70
          Length = 563

 Score = 37.9 bits (84), Expect = 0.007
 Identities = 26/76 (34%), Positives = 40/76 (52%), Gaps = 2/76 (2%)
 Frame = +2

Query: 269 IFDAKRLIGRKFEDATVQADMKHWPF--EVVSDGGKPKIKVAYKGEDKTFFPEEVSSMVL 442
           IF+ KRL+GR   D  V A  K+ PF  + +  G +P I        ++  PEEV ++ L
Sbjct: 93  IFNMKRLVGRVDTDPVVHAS-KNLPFLVQTLDIGVRPFIAALVNNAWRSTTPEEVLAIFL 151

Query: 443 TKMKETAEAYLGKLCR 490
            +++  AEA L +  R
Sbjct: 152 VELRLMAEAQLKRPVR 167



 Score = 34.3 bits (75), Expect = 0.087
 Identities = 14/41 (34%), Positives = 24/41 (58%)
 Frame = +3

Query: 87  AVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD 209
           A+GID+GT+   + V+   +V I+ N +  +   S+V F D
Sbjct: 30  ALGIDIGTSQCSIAVWNGSQVHILRNTRNQKLIKSFVTFKD 70



 Score = 31.5 bits (68), Expect = 0.61
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 8/61 (13%)
 Frame = +3

Query: 516 FNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGL-------DKKGTG-ERNVLIFDLA 671
           F+  Q    + A  ++GL+VLR++ EPTA A+ Y         D  G+G ER  +IF++ 
Sbjct: 177 FSRFQLTRFERACAMAGLHVLRLMPEPTAIALLYAQQQQMTTHDNMGSGSERLAVIFNMG 236

Query: 672 A 674
           A
Sbjct: 237 A 237


>At5g62550.1 68418.m07850 expressed protein 
          Length = 487

 Score = 30.7 bits (66), Expect = 1.1
 Identities = 20/66 (30%), Positives = 31/66 (46%)
 Frame = -2

Query: 483 SLPR*ASAVSFIFVSTMELTSSGKKVLSSPLYATLILGLPPSLTTSKGQCFMSACTVASS 304
           S+PR A  VS +  ST  L  SGKK +         L +P   T++     +S+   + S
Sbjct: 46  SMPRRARVVSAVSQSTTVLDLSGKKSVDRTKLPPRRLSIPNKPTSNSSVKSVSSSVTSLS 105

Query: 303 NLRPMR 286
            ++P R
Sbjct: 106 EVKPKR 111


>At4g24910.1 68417.m03566 hypothetical protein contains Pfam profile
           PF04669: Protein of unknown function (DUF579)
          Length = 315

 Score = 29.5 bits (63), Expect = 2.5
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%)
 Frame = -2

Query: 195 HKTEWSCCPGRWR*SPPSRAG--RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQL 28
           H++  S      R SPPS     +HQR ST    +F +R L+P  IF  S    L+ L
Sbjct: 6   HQSSLSILNPLLRFSPPSSPDNPKHQRLSTIKMPKFTVRKLIPLLIFVLSSLSVLRLL 63


>At3g63200.1 68416.m07100 patatin-related low similarity to
           patatin-like latex protein allergen Hev b 7 - Hevea
           brasiliensis, EMBL:AF113546; contains patatin domain
           PF01734
          Length = 384

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 5/47 (10%)
 Frame = +3

Query: 582 IINEPTAAAIAYGLDKKG-----TGERNVLIFDLAAVPSTCPSLPSR 707
           ++N PTAAA+ + L  K       G  ++L+  L   PST  S P R
Sbjct: 225 VMNNPTAAAVTHVLHNKRDFPSVNGVDDLLVLSLGNGPSTMSSSPGR 271


>At2g27350.5 68415.m03295 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 388

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.4 68415.m03294 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 388

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.3 68415.m03293 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 506

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.2 68415.m03292 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At2g27350.1 68415.m03291 OTU-like cysteine protease family protein
           contains Pfam profile PF02338: OTU-like cysteine
           protease
          Length = 505

 Score = 28.7 bits (61), Expect = 4.3
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +1

Query: 85  PQ*ESIWVPRTLALVSSSTGRWRSSPTTRATGPLRLMLRSQTPSVSSEMPPRT 243
           P+  S   P +   V  S G  R  PT RA GP  L+    +P+ S    PR+
Sbjct: 122 PKPSSTVNPGSNRSVLGSFGALRIGPTRRAAGPRSLVSSRSSPTGSHPSSPRS 174


>At4g27630.2 68417.m03972 expressed protein
          Length = 467

 Score = 28.3 bits (60), Expect = 5.7
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = -2

Query: 132 RHQRKSTWYPDRFLLRVLLPFCIFNQSCYLFLKQLSKR 19
           R  R   W  D F L VLL F +    CYL L+    R
Sbjct: 71  REARMVNWKVDLFCLIVLLVFMLPYYHCYLMLRNTGVR 108


>At4g34940.1 68417.m04953 armadillo/beta-catenin repeat family
           protein contains Pfam profile: PF00514
           armadillo/beta-catenin-like repeat
          Length = 664

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 11/44 (25%), Positives = 22/44 (50%)
 Frame = +2

Query: 203 HRHRASHRRCRQEPGGDDPNNTIFDAKRLIGRKFEDATVQADMK 334
           ++   +H +    P G++P +       + GR++ED   +A MK
Sbjct: 378 NQQHQNHTKGGSNPRGNNPTHVSLMGTSIKGREYEDPATKAQMK 421


>At3g11180.1 68416.m01357 oxidoreductase, 2OG-Fe(II) oxygenase
           family protein similar to leucoanthocyanidin dioxygenase
           GB:BAA20143 [Perilla frutescens], Malus domestica,
           SP|P51091; contains PF03171 2OG-Fe(II) oxygenase
           superfamily domain
          Length = 400

 Score = 27.9 bits (59), Expect = 7.5
 Identities = 23/85 (27%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
 Frame = +2

Query: 239 EPGGDDPNNTIFDAKRLI-GRKFEDATVQADMKHWPF-EVVSDGGKPKIKVAYKGEDKTF 412
           +P   D N  I D   L  G + +   +    + W F +V++ G KP++  A +   K+F
Sbjct: 87  QPEVADINIPIIDLDSLFSGNEDDKKRISEACREWGFFQVINHGVKPELMDAARETWKSF 146

Query: 413 FPEEVSSM-VLTKMKETAEAYLGKL 484
           F   V +  V +    T E Y  +L
Sbjct: 147 FNLPVEAKEVYSNSPRTYEGYGSRL 171


>At4g18375.2 68417.m02727 KH domain-containing protein contains
           similarity to RNA-binding KH-domains PF:00013
          Length = 606

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +3

Query: 174 NRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLC 320
           N+     V F+ +  LIG A +N   +   T+ S+  VS DVS    +C
Sbjct: 138 NKECRLLVPFSQSSSLIGKAGENIKRIRRRTRASVKVVSKDVSDPSHVC 186


>At4g18375.1 68417.m02726 KH domain-containing protein contains
           similarity to RNA-binding KH-domains PF:00013
          Length = 532

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 16/49 (32%), Positives = 24/49 (48%)
 Frame = +3

Query: 174 NRTTPSYVAFTDTERLIGDAAKNQVAMTPTTQYSMPNVSSDVSSKMLLC 320
           N+     V F+ +  LIG A +N   +   T+ S+  VS DVS    +C
Sbjct: 138 NKECRLLVPFSQSSSLIGKAGENIKRIRRRTRASVKVVSKDVSDPSHVC 186


>At1g68330.1 68414.m07805 expressed protein
          Length = 268

 Score = 27.5 bits (58), Expect = 9.9
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 1/72 (1%)
 Frame = +1

Query: 28  ELF*EQVTRLIKNTKWQKHPQ*ESIWVPRTLALVSSSTGRWRSSPTTRA-TGPLRLMLRS 204
           ELF E     ++  K +  PQ  +  VPR+ +L SSS+    SS ++RA    +RL    
Sbjct: 64  ELFSEGKILPVQIKKEESLPQTVTFRVPRSASLSSSSSSSSSSSSSSRAPEKKMRLKELL 123

Query: 205 QTPSVSSEMPPR 240
             P    E  PR
Sbjct: 124 LNPESDFEDKPR 135


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,940,201
Number of Sequences: 28952
Number of extensions: 403654
Number of successful extensions: 1298
Number of sequences better than 10.0: 36
Number of HSP's better than 10.0 without gapping: 1176
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1275
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1643603136
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -