BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= tesV0210.Seq (797 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g03730.1 68415.m00333 ACT domain-containing protein (ACR5) co... 29 3.6 At1g22530.1 68414.m02814 SEC14 cytosolic factor family protein /... 28 6.2 At1g15020.2 68414.m01795 thioredoxin family protein low similari... 28 6.2 At1g15020.1 68414.m01794 thioredoxin family protein low similari... 28 6.2 At5g28190.1 68418.m03413 hypothetical protein 28 8.3 At3g57780.1 68416.m06436 expressed protein 28 8.3 >At2g03730.1 68415.m00333 ACT domain-containing protein (ACR5) contains Pfam ACT domain PF01842 Length = 456 Score = 29.1 bits (62), Expect = 3.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = -2 Query: 112 RVLHQLVDQSRMPDTFEGFLDIEKDCGRVLARV 14 R LHQL+ R D +E +D E CGRV+ V Sbjct: 227 RKLHQLMFADRDYDEWENNVDDEDKCGRVIPDV 259 >At1g22530.1 68414.m02814 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus; similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus} Length = 683 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 263 YTNDIPTLEGNLQAWEVDVKLALFADDSAYFSSSNVPSAAIL 388 YT D+P EG+ +WE+ V L A F SN S ++ Sbjct: 594 YTIDLPATEGSTLSWELRV-LGADVSYGAQFEPSNEASYTVI 634 >At1g15020.2 68414.m01795 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 528 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +2 Query: 11 SNARQYTAAVFLDIEKAFERVWHAGLIHKLVQNTDLQHAYVR 136 S+ Q + A+F DIE+A E + L HK +++++ +++R Sbjct: 188 SDQEQISQAIF-DIEEATEEAFDIILAHKAIKSSETSASFIR 228 >At1g15020.1 68414.m01794 thioredoxin family protein low similarity to FAD-dependent sulfhydryl oxidase-2 [Rattus norvegicus] GI:12483919; contains Pfam profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr family Length = 502 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +2 Query: 11 SNARQYTAAVFLDIEKAFERVWHAGLIHKLVQNTDLQHAYVR 136 S+ Q + A+F DIE+A E + L HK +++++ +++R Sbjct: 188 SDQEQISQAIF-DIEEATEEAFDIILAHKAIKSSETSASFIR 228 >At5g28190.1 68418.m03413 hypothetical protein Length = 839 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/62 (29%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -2 Query: 217 AVTGRTDDXAPXTASKKDLPSRYDPSSSHVGVLEVRVLHQLVDQSRMPDTFEG-FLDIEK 41 AV + DD A +D S DPS +V + LVD D F F ++ Sbjct: 96 AVANKIDDVNVFVAVVEDCDSHDDPSQDEGASFDVTKVDDLVDNVNPLDVFSNVFSPVDD 155 Query: 40 DC 35 C Sbjct: 156 GC 157 >At3g57780.1 68416.m06436 expressed protein Length = 670 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = +1 Query: 295 PPSVGSRREVGAVCRRQRLLLVIQRPLCGHSEDAEAFGLTAPVAGPME 438 PPS + EVG + R R + +IQR G++ D E L +P+ +E Sbjct: 586 PPSSTNVAEVGDISRMSRNVSMIQRK--GYTSDDELEELDSPLTSIIE 631 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,411,710 Number of Sequences: 28952 Number of extensions: 335477 Number of successful extensions: 903 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1804564000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -