SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30166.Seq
         (892 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g77510.1 68414.m09026 protein disulfide isomerase, putative s...    83   3e-16
At1g21750.2 68414.m02723 protein disulfide isomerase, putative s...    83   3e-16
At1g21750.1 68414.m02722 protein disulfide isomerase, putative s...    83   3e-16
At5g60640.2 68418.m07611 thioredoxin family protein similar to p...    82   6e-16
At5g60640.1 68418.m07610 thioredoxin family protein similar to p...    82   6e-16
At3g54960.1 68416.m06094 thioredoxin family protein similar to p...    77   2e-14
At1g52260.1 68414.m05897 thioredoxin family protein similar to p...    74   1e-13
At2g47470.2 68415.m05924 thioredoxin family protein similar to p...    68   1e-11
At2g47470.1 68415.m05925 thioredoxin family protein similar to p...    68   1e-11
At3g16110.1 68416.m02035 thioredoxin family protein similar to p...    63   2e-10
At1g35620.1 68414.m04425 thioredoxin family protein similar to S...    62   6e-10
At1g04980.1 68414.m00497 thioredoxin family protein similar to S...    58   6e-09
At2g32920.1 68415.m04036 thioredoxin family protein similar to S...    56   3e-08
At4g27080.1 68417.m03893 thioredoxin family protein contains Pfa...    46   3e-05
At2g01270.1 68415.m00040 thioredoxin family protein low similari...    42   5e-04
At1g15020.2 68414.m01795 thioredoxin family protein low similari...    41   0.001
At1g15020.1 68414.m01794 thioredoxin family protein low similari...    41   0.001
At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2, chlorop...    41   0.001
At4g37200.1 68417.m05266 thioredoxin family protein contains Pfa...    40   0.002
At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38...    38   0.007
At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-...    38   0.007
At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38...    38   0.012
At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / P...    37   0.016
At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-...    37   0.016
At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-...    37   0.016
At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i...    37   0.016
At3g20560.1 68416.m02603 thioredoxin family protein contains Pfa...    37   0.021
At1g50950.1 68414.m05728 thioredoxin-related contains weak hit t...    37   0.021
At5g61440.1 68418.m07709 thioredoxin family protein low similari...    36   0.036
At4g04950.1 68417.m00719 thioredoxin family protein similar to P...    36   0.036
At1g34780.1 68414.m04329 protein disulfide isomerase-related con...    36   0.036
At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / P...    36   0.048
At2g33270.1 68415.m04078 thioredoxin family protein contains Pfa...    36   0.048
At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identica...    35   0.063
At1g50320.1 68414.m05641 thioredoxin x nearly identical to thior...    35   0.063
At4g29670.2 68417.m04227 thioredoxin family protein contains Pfa...    35   0.083
At4g29670.1 68417.m04226 thioredoxin family protein contains Pfa...    35   0.083
At4g26160.1 68417.m03765 thioredoxin family protein low similari...    35   0.083
At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29...    34   0.15 
At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29...    33   0.25 
At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2) i...    33   0.34 
At3g19780.1 68416.m02504 expressed protein                             33   0.34 
At1g76760.1 68414.m08933 thioredoxin family protein similar to t...    33   0.34 
At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL) i...    33   0.34 
At1g43560.1 68414.m05000 thioredoxin family protein contains Pfa...    32   0.44 
At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te...    31   0.78 
At4g32580.1 68417.m04638 thioredoxin family protein contains Pfa...    31   1.0  
At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-...    31   1.0  
At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1) i...    31   1.4  
At4g08930.1 68417.m01470 thioredoxin-related contains weak simil...    31   1.4  
At3g06730.1 68416.m00798 thioredoxin family protein contains Pfa...    30   1.8  
At1g08570.1 68414.m00950 thioredoxin family protein contains Pfa...    30   1.8  
At1g07960.3 68414.m00867 thioredoxin family protein low similari...    30   2.4  
At1g07960.2 68414.m00866 thioredoxin family protein low similari...    30   2.4  
At1g07960.1 68414.m00865 thioredoxin family protein low similari...    30   2.4  
At3g08710.1 68416.m01012 thioredoxin family protein similar to t...    29   3.1  
At1g52990.1 68414.m05997 thioredoxin family protein similar to S...    29   3.1  
At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel...    29   5.5  
At1g11530.1 68414.m01324 thioredoxin family protein similar to t...    28   7.2  
At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel...    28   9.6  
At4g16140.1 68417.m02445 proline-rich family protein contains pr...    28   9.6  
At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein ...    28   9.6  

>At1g77510.1 68414.m09026 protein disulfide isomerase, putative
           similar to protein disulfide isomerase precursor
           GB:P29828 GI:4704766 [Medicago sativa]; Pfam HMM hit:
           PF00085 Thioredoxins
          Length = 508

 Score = 82.6 bits (195), Expect = 3e-16
 Identities = 38/87 (43%), Positives = 61/87 (70%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNG--SPIDYSGGRQADDIISWLKKKTG 426
           P+ LAK+DA++E  ++ A  Y ++G+PTLK  RNG  S  DY+G R+A+ I+++LKK++G
Sbjct: 81  PLALAKIDASEEANKEFANEYKIQGFPTLKILRNGGKSVQDYNGPREAEGIVTYLKKQSG 140

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P +VE+ SA+ A E++    V+  G F
Sbjct: 141 PASVEIKSADSATEVVGEKNVVAVGVF 167



 Score = 71.7 bits (168), Expect = 6e-13
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 2/71 (2%)
 Frame = +2

Query: 50  FTAIALLGLALGD--EVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEY 223
           F+ + LL L +       T+E VL L  +NF   I+  ++I+VEFYAPWCGHC+ LAPEY
Sbjct: 9   FSILLLLSLFVSSIRSEETKEFVLTLDHSNFTETISKHDFIVVEFYAPWCGHCQKLAPEY 68

Query: 224 AKAATKLAEED 256
            KAA++L+  +
Sbjct: 69  EKAASELSSHN 79



 Score = 47.2 bits (107), Expect = 1e-05
 Identities = 19/45 (42%), Positives = 31/45 (68%), Gaps = 3/45 (6%)
 Frame = +2

Query: 92  VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +P E N    +V++++  + V  + + +L+EFYAPWCGHC+ LAP
Sbjct: 366 IPAENNEPVKVVVAESLDDIVFKSGKNVLIEFYAPWCGHCQKLAP 410



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 17/53 (32%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKKT 423
           +AK+DAT     ++++ V+G+PT+ F   +G+ + Y G R  +D I++++K +
Sbjct: 427 IAKLDATANDIPSDTFDVKGFPTIYFRSASGNVVVYEGDRTKEDFINFVEKNS 479


>At1g21750.2 68414.m02723 protein disulfide isomerase, putative
           similar to SP|P29828 Protein disulfide isomerase
           precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform
           contains non-consensus GA donor splice site at intron 9
          Length = 487

 Score = 82.6 bits (195), Expect = 3e-16
 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 426
           P+ LAK+DA++E  ++ A  Y V+G+PT+K FRNG     +Y+G R+A+ I+++LKK++G
Sbjct: 82  PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P + E+ SA+ A E++    V+V G F
Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%)
 Frame = +2

Query: 50  FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           FT  ++L L+L       +E  T+E VL L   NF   I   ++I+VEFYAPWCGHCK L
Sbjct: 6   FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65

Query: 212 APEYAKAATKLA 247
           APEY KAA+ L+
Sbjct: 66  APEYEKAASALS 77



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%)
 Frame = +2

Query: 92  VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +P E N    +V+S +  + V+ + + +L+EFYAPWCGHC+ LAP
Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412



 Score = 36.3 bits (80), Expect = 0.027
 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLK 414
           S + +AK+DAT      +++ V+G+PT+ F   +G+ + Y G RQ + +  +++
Sbjct: 425 SSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRQRESLYLFIR 478


>At1g21750.1 68414.m02722 protein disulfide isomerase, putative
           similar to SP|P29828 Protein disulfide isomerase
           precursor (PDI) (EC 5.3.4.1) {Medicago sativa}; isoform
           contains non-consensus GA donor splice site at intron 9
          Length = 501

 Score = 82.6 bits (195), Expect = 3e-16
 Identities = 37/87 (42%), Positives = 61/87 (70%), Gaps = 4/87 (4%)
 Frame = +1

Query: 259 PIKLAKVDATQE--QDLAESYGVRGYPTLKFFRNGSPI--DYSGGRQADDIISWLKKKTG 426
           P+ LAK+DA++E  ++ A  Y V+G+PT+K FRNG     +Y+G R+A+ I+++LKK++G
Sbjct: 82  PVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSG 141

Query: 427 PPAVEVTSAEQAKELIDANTVIVFGFF 507
           P + E+ SA+ A E++    V+V G F
Sbjct: 142 PASAEIKSADDASEVVSDKKVVVVGIF 168



 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 36/72 (50%), Positives = 46/72 (63%), Gaps = 6/72 (8%)
 Frame = +2

Query: 50  FTAIALLGLAL------GDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSL 211
           FT  ++L L+L       +E  T+E VL L   NF   I   ++I+VEFYAPWCGHCK L
Sbjct: 6   FTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQL 65

Query: 212 APEYAKAATKLA 247
           APEY KAA+ L+
Sbjct: 66  APEYEKAASALS 77



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 20/45 (44%), Positives = 31/45 (68%), Gaps = 3/45 (6%)
 Frame = +2

Query: 92  VPTEENV---LVLSKANFETVITTTEYILVEFYAPWCGHCKSLAP 217
           +P E N    +V+S +  + V+ + + +L+EFYAPWCGHC+ LAP
Sbjct: 368 IPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAP 412



 Score = 44.8 bits (101), Expect = 8e-05
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 4/75 (5%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKF-FRNGSPIDYSGGRQADDIISWLKKK---T 423
           S + +AK+DAT      +++ V+G+PT+ F   +G+ + Y G R  +D IS++ K     
Sbjct: 425 SSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTV 484

Query: 424 GPPAVEVTSAEQAKE 468
           G P  E  + E+ K+
Sbjct: 485 GEPKKEEETTEEVKD 499


>At5g60640.2 68418.m07611 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 536

 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 33/81 (40%), Positives = 56/81 (69%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LAK+DAT+E +LA+ Y V+G+PTL FF +G    Y+GGR  + I++W+KKK GP    
Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213

Query: 442 VTSAEQAKELIDANTVIVFGF 504
           +T+ + A++++ +   +V G+
Sbjct: 214 LTTLDDAEKVLTSGNKVVLGY 234



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 4/69 (5%)
 Frame = +2

Query: 68  LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           LG    D +PT    E++V+V+ + NF  VI   +Y+LVEFYAPWCGHC+SLAPEYA AA
Sbjct: 87  LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146

Query: 236 TKLAEEDLL 262
           T+L E+ ++
Sbjct: 147 TELKEDGVV 155



 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%)
 Frame = +2

Query: 86  DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           D +P   +E+V ++   NF E V+  ++ +L+E YAPWCGHC++L P Y K A  L   D
Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492

Query: 257 LL 262
            L
Sbjct: 493 SL 494


>At5g60640.1 68418.m07610 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 597

 Score = 81.8 bits (193), Expect = 6e-16
 Identities = 33/81 (40%), Positives = 56/81 (69%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVE 441
           + LAK+DAT+E +LA+ Y V+G+PTL FF +G    Y+GGR  + I++W+KKK GP    
Sbjct: 154 VVLAKIDATEENELAQEYRVQGFPTLLFFVDGEHKPYTGGRTKETIVTWVKKKIGPGVYN 213

Query: 442 VTSAEQAKELIDANTVIVFGF 504
           +T+ + A++++ +   +V G+
Sbjct: 214 LTTLDDAEKVLTSGNKVVLGY 234



 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 37/69 (53%), Positives = 50/69 (72%), Gaps = 4/69 (5%)
 Frame = +2

Query: 68  LGLALGDEVPT----EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           LG    D +PT    E++V+V+ + NF  VI   +Y+LVEFYAPWCGHC+SLAPEYA AA
Sbjct: 87  LGNPDSDPLPTPEIDEKDVVVIKERNFTDVIENNQYVLVEFYAPWCGHCQSLAPEYAAAA 146

Query: 236 TKLAEEDLL 262
           T+L E+ ++
Sbjct: 147 TELKEDGVV 155



 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 26/62 (41%), Positives = 38/62 (61%), Gaps = 3/62 (4%)
 Frame = +2

Query: 86  DEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           D +P   +E+V ++   NF E V+  ++ +L+E YAPWCGHC++L P Y K A  L   D
Sbjct: 433 DPIPEKNDEDVKIVVGDNFDEIVLDDSKDVLLEVYAPWCGHCQALEPMYNKLAKHLRSID 492

Query: 257 LL 262
            L
Sbjct: 493 SL 494


>At3g54960.1 68416.m06094 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 579

 Score = 76.6 bits (180), Expect = 2e-14
 Identities = 35/80 (43%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAVEV 444
           LAK+DAT+E DLA+ Y ++G+PT+  F +G     Y G R  D I++WLKKK  P    +
Sbjct: 151 LAKIDATEEGDLAQKYEIQGFPTVFLFVDGEMRKTYEGERTKDGIVTWLKKKASPSIHNI 210

Query: 445 TSAEQAKELIDANTVIVFGF 504
           T+ E+A+ ++ A   +VFGF
Sbjct: 211 TTKEEAERVLSAEPKLVFGF 230



 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 26/48 (54%), Positives = 35/48 (72%)
 Frame = +2

Query: 101 EENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           E++V VL+K NF   +    + +VEFYAPWCG C++L PEYA AAT+L
Sbjct: 98  EKDVAVLTKDNFTEFVGNNSFAMVEFYAPWCGACQALTPEYAAAATEL 145



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 3/83 (3%)
 Frame = +2

Query: 23  DNIEMRVLIFTAIALLGLALGDEVP--TEENVLVLSKANF-ETVITTTEYILVEFYAPWC 193
           +NI+     F A  L      D +P   + +V V+   NF E V+  ++ +L+E YAPWC
Sbjct: 408 NNIKTLAEDFLADKLKPFYKSDPLPENNDGDVKVIVGNNFDEIVLDESKDVLLEIYAPWC 467

Query: 194 GHCKSLAPEYAKAATKLAEEDLL 262
           GHC+S  P Y K    L   D L
Sbjct: 468 GHCQSFEPIYNKLGKYLKGIDSL 490


>At1g52260.1 68414.m05897 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 537

 Score = 73.7 bits (173), Expect = 1e-13
 Identities = 29/84 (34%), Positives = 50/84 (59%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S + +AK+D  +   +A    ++G+PTL  F NG+ + Y+GG  A+DI+ W++KKTG P 
Sbjct: 128 SSVLMAKIDGDRYSKIASELEIKGFPTLLLFVNGTSLTYNGGSSAEDIVIWVQKKTGAPI 187

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
           + + + ++A   +D     V G F
Sbjct: 188 ITLNTVDEAPRFLDKYHTFVLGLF 211



 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 20/47 (42%), Positives = 27/47 (57%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           VL L+    + VI   E+++V  YAPWC     L P +A+AAT L E
Sbjct: 79  VLELNGDYTKRVIDGNEFVMVLGYAPWCARSAELMPRFAEAATALKE 125


>At2g47470.2 68415.m05924 thioredoxin family protein similar to
           protein disulfide isomerase [Dictyostelium discoideum]
           GI:2627440; contains Pfam profile: PF00085 Thioredoxin
          Length = 266

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%)
 Frame = +2

Query: 104 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +NV+VL+  NF E V+   + +LVEFYAPWCGHCKSLAP Y K AT   +E+
Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192



 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           I+   ALL L L   V   ++V+VL+  +FE  +   +  LVEFYAPWCGHCK LAPEY 
Sbjct: 6   IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63

Query: 227 K--AATKLAEEDLLS 265
           K  A+ K A+  L++
Sbjct: 64  KLGASFKKAKSVLIA 78



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 426
           + +A +DA   + L E YGV G+PTLKFF   N +  DY GGR  DD +S++ +K+G
Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           + +AKVD  +++ +   YGV GYPT+++F  GS  P  Y G R A+ +  ++ K+ G
Sbjct: 75  VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131


>At2g47470.1 68415.m05925 thioredoxin family protein similar to
           protein disulfide isomerase [Dictyostelium discoideum]
           GI:2627440; contains Pfam profile: PF00085 Thioredoxin
          Length = 361

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%)
 Frame = +2

Query: 104 ENVLVLSKANF-ETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEED 256
           +NV+VL+  NF E V+   + +LVEFYAPWCGHCKSLAP Y K AT   +E+
Sbjct: 141 QNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEE 192



 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 35/75 (46%), Positives = 47/75 (62%), Gaps = 2/75 (2%)
 Frame = +2

Query: 47  IFTAIALLGLALGDEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           I+   ALL L L   V   ++V+VL+  +FE  +   +  LVEFYAPWCGHCK LAPEY 
Sbjct: 6   IWFGFALLALLLVSAVA--DDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYE 63

Query: 227 K--AATKLAEEDLLS 265
           K  A+ K A+  L++
Sbjct: 64  KLGASFKKAKSVLIA 78



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 26/57 (45%), Positives = 37/57 (64%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKKKTG 426
           + +A +DA   + L E YGV G+PTLKFF   N +  DY GGR  DD +S++ +K+G
Sbjct: 194 VVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSG 250



 Score = 48.0 bits (109), Expect = 8e-06
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGS--PIDYSGGRQADDIISWLKKKTG 426
           + +AKVD  +++ +   YGV GYPT+++F  GS  P  Y G R A+ +  ++ K+ G
Sbjct: 75  VLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGG 131


>At3g16110.1 68416.m02035 thioredoxin family protein similar to
           protein disulfide isomerase GI:5902592 from [Volvox
           carteri f. nagariensis], GI:2708314 from Chlamydomonas
           reinhardtii; contains Pfam profile: PF00085 Thioredoxin
          Length = 534

 Score = 63.3 bits (147), Expect = 2e-10
 Identities = 24/84 (28%), Positives = 49/84 (58%)
 Frame = +1

Query: 256 SPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPA 435
           S + +AK+D  +   +A    ++G+PTL  F NG+   Y+GG  +++I+ W++KKTG   
Sbjct: 126 SSVLMAKIDGERYSKVASQLEIKGFPTLLLFVNGTSQSYTGGFSSEEIVIWVQKKTGAST 185

Query: 436 VEVTSAEQAKELIDANTVIVFGFF 507
           +++ + ++A   +  +   + G F
Sbjct: 186 IKLDTVDEASGFLKKHHTFILGLF 209



 Score = 44.0 bits (99), Expect = 1e-04
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           V+ L+  N + +I   EY++V  YAPWC     L P +A+AAT L E
Sbjct: 77  VVELNGDNTKRLIDGNEYVMVLGYAPWCARSAELMPRFAEAATDLKE 123


>At1g35620.1 68414.m04425 thioredoxin family protein similar to
           SP|Q43116 Protein disulfide isomerase precursor (PDI)
           (EC 5.3.4.1) {Ricinus communis}; contains Pfam profile
           PF00085: Thioredoxin
          Length = 440

 Score = 61.7 bits (143), Expect = 6e-10
 Identities = 27/55 (49%), Positives = 37/55 (67%)
 Frame = +2

Query: 86  DEVPTEENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           D+   +  VL L+ +NF++ I+T + I V+FYAPWCGHCK L PE   AA  LA+
Sbjct: 26  DQFTLDGTVLELTDSNFDSAISTFDCIFVDFYAPWCGHCKRLNPELDAAAPILAK 80



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPP 432
           + PI +AK++A +   LA    +  +PTL  + +G P++Y G R+AD ++ +LKK   P 
Sbjct: 82  KQPIVIAKLNADKYSRLARKIEIDAFPTLMLYNHGVPMEYYGPRKADLLVRYLKKFVAPD 141

Query: 433 AVEVTSAEQAKELI-DANT 486
              + S    KE + DA T
Sbjct: 142 VAVLESDSTVKEFVEDAGT 160


>At1g04980.1 68414.m00497 thioredoxin family protein similar to
           SP|Q63081 Protein disulfide isomerase A6 precursor (EC
           5.3.4.1) {Rattus norvegicus}; contains Pfam profile
           PF00085: Thioredoxin
          Length = 443

 Score = 58.4 bits (135), Expect = 6e-09
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEYI-LVEFYAPWCGHCKSLAPEYAKAATKL 244
           L+ +NF+ ++T ++ + +VEF+APWCGHCK LAPE+ KAA  L
Sbjct: 168 LNSSNFDELVTESKELWIVEFFAPWCGHCKKLAPEWKKAANNL 210



 Score = 54.8 bits (126), Expect = 7e-08
 Identities = 23/46 (50%), Positives = 34/46 (73%), Gaps = 1/46 (2%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           VL L+ +NF++ V+ +   +LVEF+APWCGHC+SL P + K A+ L
Sbjct: 30  VLQLTPSNFKSKVLNSNGVVLVEFFAPWCGHCQSLTPTWEKVASTL 75



 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGS-PIDYSGGRQADDIISWLKKK 420
           +A +DA   + +++ YGVRG+PT+K F  G  PIDY G R A  I  +  K+
Sbjct: 81  VAAIDADAHKSVSQDYGVRGFPTIKVFVPGKPPIDYQGARDAKSISQFAIKQ 132



 Score = 39.1 bits (87), Expect = 0.004
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 7/91 (7%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRN--GSPIDYSGGRQADDIISW----LK 414
           +  +KL  V+   EQ +   + V+G+PT+  F +   SP+ Y G R A  I S+    L+
Sbjct: 211 KGKVKLGHVNCDAEQSIKSRFKVQGFPTILVFGSDKSSPVPYEGARSASAIESFALEQLE 270

Query: 415 KKTGPPAV-EVTSAEQAKELIDANTVIVFGF 504
              GP  V E+T  +  ++   +  +    F
Sbjct: 271 SNAGPAEVTELTGPDVMEDKCGSAAICFVSF 301


>At2g32920.1 68415.m04036 thioredoxin family protein similar to
           SP|Q15084 Protein disulfide isomerase A6 precursor (EC
           5.3.4.1) {Homo sapiens}; contains Pfam profile PF00085:
           Thioredoxin
          Length = 440

 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 24/43 (55%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +2

Query: 119 LSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           L+ +NF+  VI + E  +VEF+APWCGHCK LAPE+ +AA  L
Sbjct: 167 LNASNFDDLVIESNELWIVEFFAPWCGHCKKLAPEWKRAAKNL 209



 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%)
 Frame = +2

Query: 110 VLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKL 244
           V+ L+ +NF++ V+ +   +LVEF+APWCGHCK+L P + K A  L
Sbjct: 32  VVQLTASNFKSKVLNSNGVVLVEFFAPWCGHCKALTPTWEKVANIL 77



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNG-SPIDYSGGRQADDIISWLKKK 420
           +A +DA   Q  A+ YG++G+PT+K F  G +PIDY G R A  I ++  K+
Sbjct: 83  VAAIDADAHQSAAQDYGIKGFPTIKVFVPGKAPIDYQGARDAKSIANFAYKQ 134



 Score = 35.5 bits (78), Expect = 0.048
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 4/66 (6%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFF--RNGSPIDYSGGRQADDIISWLKK--KTGP 429
           +KL  V+   EQ +   + V+G+PT+  F     SP  Y G R A  I S+  +  ++  
Sbjct: 213 VKLGHVNCDVEQSIMSRFKVQGFPTILVFGPDKSSPYPYEGARSASAIESFASELVESSA 272

Query: 430 PAVEVT 447
             VEVT
Sbjct: 273 GPVEVT 278


>At4g27080.1 68417.m03893 thioredoxin family protein contains Pfam
           PF00085: Thioredoxin
          Length = 480

 Score = 46.0 bits (104), Expect = 3e-05
 Identities = 23/58 (39%), Positives = 32/58 (55%), Gaps = 2/58 (3%)
 Frame = +2

Query: 83  GDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           GDE   E  E+ + L+  NF+T       ++V FYAPWC  C  L P + KAA ++ E
Sbjct: 132 GDETGEEIVEDSVPLTGRNFDTFTHQFPILVVNFYAPWCYWCNLLKPSWEKAAKQIKE 189



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 17/33 (51%), Positives = 23/33 (69%)
 Frame = +1

Query: 268 LAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI 366
           LAKVD TQE DL     ++GYP+++ FR GS +
Sbjct: 201 LAKVDCTQEGDLCRRNHIQGYPSIRIFRKGSDL 233


>At2g01270.1 68415.m00040 thioredoxin family protein low similarity
           to quiescin [Homo sapiens] GI:13257405; contains Pfam
           profiles PF00085: Thioredoxin, PF04777: Erv1 / Alr
           family
          Length = 495

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 17/47 (36%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +2

Query: 101 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           ++  + L+  NF++V+  T  +Y +VEF+A WC  C++  P Y K A
Sbjct: 34  KDKAVELNTTNFDSVLKDTPAKYAVVEFFAHWCPACRNYKPHYEKVA 80


>At1g15020.2 68414.m01795 thioredoxin family protein low similarity
           to FAD-dependent sulfhydryl oxidase-2 [Rattus
           norvegicus] GI:12483919; contains Pfam profiles PF00085:
           Thioredoxin, PF04777: Erv1 / Alr family
          Length = 528

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +2

Query: 101 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           ++N + L+  NF++V   +  +Y ++EF+A WC  C++  P Y K A
Sbjct: 40  KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86


>At1g15020.1 68414.m01794 thioredoxin family protein low similarity
           to FAD-dependent sulfhydryl oxidase-2 [Rattus
           norvegicus] GI:12483919; contains Pfam profiles PF00085:
           Thioredoxin, PF04777: Erv1 / Alr family
          Length = 502

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 16/47 (34%), Positives = 29/47 (61%), Gaps = 2/47 (4%)
 Frame = +2

Query: 101 EENVLVLSKANFETVI--TTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           ++N + L+  NF++V   +  +Y ++EF+A WC  C++  P Y K A
Sbjct: 40  KDNAIELNATNFDSVFQDSPAKYAVLEFFAHWCPACRNYKPHYEKVA 86


>At1g62180.1 68414.m07014 5'-adenylylsulfate reductase 2,
           chloroplast (APR2) (APSR) / adenosine 5'-phosphosulfate
           5'-adenylylsulfate (APS) sulfotransferase 2 /
           3'-phosphoadenosine-5'-phosphosulfate (PAPS) reductase
           homolog 43 (PRH-43) identical to SP|P92981
           5'-adenylylsulfate reductase 2, chloroplast precursor
           (EC 1.8.4.9) (Adenosine 5'-phosphosulfate
           5'-adenylylsulfate sulfotransferase 2) (APS
           sulfotransferase 2) (Thioredoxin independent APS
           reductase 2) (3'-phosphoadenosine-5'-phosphosulfate
           reductase homolog 43) (PAPS reductase homolog 43)
           (Prh-43) {Arabidopsis thaliana}; identical to cDNA PAPS
           reductase homolog (PRH43) GI:1710115
          Length = 454

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           E+    NV+ LSK   E ++      E  LV  YAPWC  C+++   Y + A KLA
Sbjct: 337 EIFESNNVVALSKGGVENLLKLENRKEAWLVVLYAPWCPFCQAMEASYIELAEKLA 392


>At4g37200.1 68417.m05266 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin; identical to cDNA
           thioredoxin-like protein (hcf164 gene) GI;12049652
          Length = 261

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 2/70 (2%)
 Frame = +2

Query: 26  NIEMRVLIFTAIALLGLALGDEVPTEENV--LVLSKANFETVITTTEYILVEFYAPWCGH 199
           +I  RV   T IA L L +   +    ++  L  S   +E  ++  +  +VEFYA WC  
Sbjct: 93  DINRRVAAVTVIAALSLFVSTRLDFGISLKDLTASALPYEEALSNGKPTVVEFYADWCEV 152

Query: 200 CKSLAPEYAK 229
           C+ LAP+  K
Sbjct: 153 CRELAPDVYK 162


>At1g69880.1 68414.m08042 thioredoxin, putative similar to SP|Q38879
           Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana};
           contains Pfam profile: PF00085 Thioredoxin
          Length = 148

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 14/46 (30%), Positives = 26/46 (56%)
 Frame = +2

Query: 125 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           K+    +  T + +++EF A WCG CK+L P+  + A K  + + +
Sbjct: 49  KSRLNALKDTNKLLVIEFTAKWCGPCKTLEPKLEELAAKYTDVEFV 94


>At1g03680.1 68414.m00347 thioredoxin M-type 1, chloroplast (TRX-M1)
           nearly identical to SP|O48737 Thioredoxin M-type 1,
           chloroplast precursor (TRX-M1) {Arabidopsis thaliana};
           similar to ESTs gb|T13714, gb|H76398, gb|N37762,
           gb|AA042639, gb|T21104, emb|Z30901
          Length = 179

 Score = 38.3 bits (85), Expect = 0.007
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)
 Frame = +2

Query: 98  TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           T   + V++ + +++ V+   E + V+F+APWCG CK + P   + A K A
Sbjct: 72  TATGIPVVNDSTWDSLVLKADEPVFVDFWAPWCGPCKMIDPIVNELAQKYA 122


>At1g59730.1 68414.m06725 thioredoxin, putative similar to SP|Q38879
           Thioredoxin H-type 2 (TRX-H-2) {Arabidopsis thaliana};
           contains Pfam profile: PF00085 Thioredoxin
          Length = 129

 Score = 37.5 bits (83), Expect = 0.012
 Identities = 13/42 (30%), Positives = 28/42 (66%)
 Frame = +2

Query: 125 KANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAE 250
           K+ F+++  + + ++++F A WCG CK++ P   + A+K +E
Sbjct: 33  KSLFDSMKGSNKLLVIDFTAVWCGPCKAMEPRVREIASKYSE 74


>At4g04610.1 68417.m00674 5'-adenylylsulfate reductase (APR1) / PAPS
           reductase homolog (PRH19) identical to
           5'-adenylylsulfate reductase [Arabidopsis thaliana]
           GI:2738756; identical to cDNA PAPS reductase homolog
           (PRH19) GI:1710111
          Length = 465

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
 Frame = +2

Query: 104 ENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATKLA 247
           EN++ LS+   E ++      E  +V  YAPWC  C+++   Y + A KLA
Sbjct: 353 ENLVTLSRQGIENLMKLENRKEPWIVVLYAPWCPFCQAMEASYDELADKLA 403


>At4g03520.1 68417.m00480 thioredoxin M-type 2, chloroplast (TRX-M2)
           nearly identical to SP|Q9SEU8 Thioredoxin M-type 2,
           chloroplast precursor (TRX-M2) {Arabidopsis thaliana}
          Length = 186

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 14/41 (34%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +2

Query: 98  TEENVLVLSKANFET-VITTTEYILVEFYAPWCGHCKSLAP 217
           T  ++ V++ + +++ V+  T  ++V+F+APWCG CK + P
Sbjct: 78  TTTDIQVVNDSTWDSLVLKATGPVVVDFWAPWCGPCKMIDP 118


>At3g15360.1 68416.m01948 thioredoxin M-type 4, chloroplast (TRX-M4)
           nearly identical to SP|Q9SEU6 Thioredoxin M-type 4,
           chloroplast precursor (TRX-M4) {Arabidopsis thaliana}
          Length = 193

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%)
 Frame = +2

Query: 119 LSKANFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           LS + ++T +  ++  +LVEF+APWCG C+ + P
Sbjct: 91  LSDSEWQTKVLESDVPVLVEFWAPWCGPCRMIHP 124



 Score = 28.7 bits (61), Expect = 5.5
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = +1

Query: 265 KLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369
           K  K++  +  + A  YG+R  PT+  F+ G   D
Sbjct: 138 KFYKINTDESPNTANRYGIRSVPTVIIFKGGEKKD 172


>At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN)
           identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4)
           {Arabidopsis thaliana}
          Length = 119

 Score = 37.1 bits (82), Expect = 0.016
 Identities = 17/51 (33%), Positives = 27/51 (52%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           KVD  + Q +A+ +GV   PT  F + G  +D   G   +D+ + + K TG
Sbjct: 65  KVDVDELQSVAKEFGVEAMPTFVFIKAGEVVDKLVGANKEDLQAKIVKHTG 115



 Score = 28.7 bits (61), Expect = 5.5
 Identities = 10/30 (33%), Positives = 18/30 (60%)
 Frame = +2

Query: 152 TTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           + + I+++F A WC  C+ +AP +   A K
Sbjct: 27  SNKLIVIDFTASWCPPCRMIAPIFNDLAKK 56


>At3g20560.1 68416.m02603 thioredoxin family protein contains Pfam
           profile PF00085: Thioredoxin
          Length = 483

 Score = 36.7 bits (81), Expect = 0.021
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 2/63 (3%)
 Frame = +2

Query: 53  TAIALLGLALGDEVPTE--ENVLVLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYA 226
           + +AL  +  G+E   E  +  + L+ A+FE +      ++V F APWC     L P + 
Sbjct: 122 SGLALHNINHGEETKEEFPDGAIPLTSASFEALSHHFPILVVNFNAPWCYWSNRLKPSWE 181

Query: 227 KAA 235
           KAA
Sbjct: 182 KAA 184



 Score = 35.5 bits (78), Expect = 0.048
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 10/66 (15%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 411
           + L  VD T+E  L +   ++GYP+++ FR GS +           Y G R  D I+  +
Sbjct: 199 VLLGNVDCTEEPALCKRNHIQGYPSIRIFRKGSDLREDHGHHEHESYYGDRDTDSIVKMV 258

Query: 412 KKKTGP 429
           +    P
Sbjct: 259 EGLVAP 264


>At1g50950.1 68414.m05728 thioredoxin-related contains weak hit to
           Pfam PF00085: Thioredoxin; contains 2 predicted
           transmembrane domains
          Length = 484

 Score = 36.7 bits (81), Expect = 0.021
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 10/66 (15%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPI----------DYSGGRQADDIISWL 411
           + L  VD T+E  L +S  ++GYP+++ FR GS +           Y G R  D ++  +
Sbjct: 200 VLLGSVDCTEEPTLCKSNHIQGYPSIRIFRRGSGLREDHGNHEHESYYGDRDTDSLVKMV 259

Query: 412 KKKTGP 429
           ++   P
Sbjct: 260 EELLKP 265



 Score = 33.9 bits (74), Expect = 0.15
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +2

Query: 119 LSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAA 235
           L+ A FE      + ++V FYAPWC     L P + KA+
Sbjct: 147 LTGAAFEKFTHHFQILVVNFYAPWCYWSNRLKPSWVKAS 185


>At5g61440.1 68418.m07709 thioredoxin family protein low similarity
           to thioredoxin [Callithrix jacchus] GI:13560979;
           contains Pfam profile: PF00085 Thioredoxin
          Length = 245

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 3/52 (5%)
 Frame = +2

Query: 89  EVPTEENVLVLSKANF--ETVITTTEYILV-EFYAPWCGHCKSLAPEYAKAA 235
           E  T  N+L +  AN   ++++   + ++V +FY+P CG CKSL P+  + A
Sbjct: 80  EKSTNHNMLEIQSANHLVDSLLNAGDRLVVLDFYSPGCGGCKSLHPKICQLA 131


>At4g04950.1 68417.m00719 thioredoxin family protein similar to
           PKCq-interacting protein PICOT from [Mus musculus]
           GI:6840949, [Rattus norvegicus] GI:6840951; contains
           Pfam profile PF00085: Thioredoxin
          Length = 488

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 23/63 (36%), Positives = 33/63 (52%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           +V+A +  +++E+Y V   P   FF++G  +D   G  AD   S L  K G  A   TSA
Sbjct: 57  RVEAEEHPEISEAYSVAAVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSSTSA 112

Query: 454 EQA 462
           E A
Sbjct: 113 EPA 115


>At1g34780.1 68414.m04329 protein disulfide isomerase-related
           contains weak similarity to Pfam:P08003 protein
           disulfide isomerase A4 precursor (Protein ERp-72, ERp72)
           [Mus musculus]
          Length = 310

 Score = 35.9 bits (79), Expect = 0.036
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 313 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSAEQA 462
           YGV G+PTL    +     Y G R  D ++++    TG   ++ TS E++
Sbjct: 131 YGVHGFPTLLLLNSTMRARYRGTRMLDSLVAFYSDVTGIETLDKTSLERS 180


>At4g21990.1 68417.m03183 5'-adenylylsulfate reductase (APR3) / PAPS
           reductase homolog (PRH26) identical to
           5'-adenylylsulfate reductase [Arabidopsis thaliana]
           GI:2738760; identical to cDNA PAPS reductase homolog
           (PRH26) GI:1710113
          Length = 458

 Score = 35.5 bits (78), Expect = 0.048
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 71  GLALGDEVPTEENVLVLSKANFETVI---TTTEYILVEFYAPWCGHCKSLAPEYAKAATK 241
           G A   ++   ENV+ LS+   E ++      E  +V  YAPWC  C+++   + + A K
Sbjct: 335 GTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLYAPWCPFCQAMEASFDELADK 394

Query: 242 L 244
           L
Sbjct: 395 L 395


>At2g33270.1 68415.m04078 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin
          Length = 273

 Score = 35.5 bits (78), Expect = 0.048
 Identities = 14/33 (42%), Positives = 22/33 (66%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           ++V+F++P CG CK+L P+  K A K  E + L
Sbjct: 116 VVVDFFSPSCGGCKALHPKICKIAEKNPEVEFL 148


>At3g51030.1 68416.m05587 thioredoxin H-type 1 (TRX-H-1) identical
           to SP|P29448 Thioredoxin H-type 1 (TRX-H-1) {Arabidopsis
           thaliana}
          Length = 114

 Score = 35.1 bits (77), Expect = 0.063
 Identities = 13/27 (48%), Positives = 19/27 (70%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATKL 244
           ++V+F A WCG C+ +AP +A  A KL
Sbjct: 31  VVVDFTASWCGPCRFIAPFFADLAKKL 57



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 13/48 (27%), Positives = 25/48 (52%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           KVD  + + +A  + ++  PT  F + G  +D   G + D++ S + K
Sbjct: 64  KVDTDELKSVASDWAIQAMPTFMFLKEGKILDKVVGAKKDELQSTIAK 111


>At1g50320.1 68414.m05641 thioredoxin x nearly identical to
           thioredoxin x GB:AAF15952 GI:6539616 from [Arabidopsis
           thaliana]
          Length = 182

 Score = 35.1 bits (77), Expect = 0.063
 Identities = 13/26 (50%), Positives = 18/26 (69%)
 Frame = +2

Query: 140 TVITTTEYILVEFYAPWCGHCKSLAP 217
           TV+ + + +LVEF A WCG CK + P
Sbjct: 82  TVLESAQPVLVEFVATWCGPCKLIYP 107


>At4g29670.2 68417.m04227 thioredoxin family protein contains Pfam
           profile PF00085: Thioredoxin
          Length = 236

 Score = 34.7 bits (76), Expect = 0.083
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++VEFY  WC  C++L P+  K A +
Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151


>At4g29670.1 68417.m04226 thioredoxin family protein contains Pfam
           profile PF00085: Thioredoxin
          Length = 235

 Score = 34.7 bits (76), Expect = 0.083
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++VEFY  WC  C++L P+  K A +
Sbjct: 126 VIVEFYGTWCASCRALFPKLCKTAVE 151


>At4g26160.1 68417.m03765 thioredoxin family protein low similarity
           to thioredoxin [Ictalurus punctatus] GI:9837585;
           contains Pfam profile: PF00085 Thioredoxin
          Length = 221

 Score = 34.7 bits (76), Expect = 0.083
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAA 235
           ++V+FY  WCG C+++ P+  K A
Sbjct: 116 VIVDFYGTWCGSCRAMFPKLCKTA 139



 Score = 29.1 bits (62), Expect = 4.1
 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 2/38 (5%)
 Frame = +1

Query: 406 WLKKKTGPPAVEVTSAEQ-AKELIDA-NTVIVFGFFWT 513
           W ++K GP  +++TSAEQ    L DA + +++  F+ T
Sbjct: 86  WWERKAGPNMIDITSAEQFLNALKDAGDRLVIVDFYGT 123


>At5g16400.1 68418.m01917 thioredoxin, putative similar to SP|P29450
           Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum
           sativum}; contains Pfam profile: PF00085 Thioredoxin
          Length = 185

 Score = 33.9 bits (74), Expect = 0.15
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++++ Y  WCG CK +AP+Y + + K
Sbjct: 100 VVLDMYTQWCGPCKVIAPKYKELSEK 125


>At3g02730.1 68416.m00265 thioredoxin, putative similar to SP|P29450
           Thioredoxin F-type, chloroplast precursor (TRX-F) {Pisum
           sativum}; contains Pfam profile: PF00085 Thioredoxin
          Length = 178

 Score = 33.1 bits (72), Expect = 0.25
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++++ Y  WCG CK +AP+Y   + K
Sbjct: 90  VVLDMYTQWCGPCKVIAPKYKALSEK 115


>At5g39950.1 68418.m04844 thioredoxin H-type 2 (TRX-H-2) (Gif2)
           identical to SP|Q38879 Thioredoxin H-type 2 (TRX-H-2)
           {Arabidopsis thaliana}; identical to cDNA (Gif2) mRNA
           for thioredoxin GI:992963
          Length = 133

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 12/44 (27%), Positives = 23/44 (52%)
 Frame = +2

Query: 131 NFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +F  +  + + ++V+F A WCG C+ + P     A K  + D +
Sbjct: 39  HFNEIKESNKLLVVDFSASWCGPCRMIEPAIHAMADKFNDVDFV 82


>At3g19780.1 68416.m02504 expressed protein
          Length = 1014

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 15/49 (30%), Positives = 25/49 (51%)
 Frame = +2

Query: 116 VLSKANFETVITTTEYILVEFYAPWCGHCKSLAPEYAKAATKLAEEDLL 262
           +L++ NF + I    ++L+    PWCG  +SL  E  +   +  E  LL
Sbjct: 29  ILTEQNFSSQIRLHPHVLLFVTTPWCGESRSLKYEITQMVQRREEFGLL 77


>At1g76760.1 68414.m08933 thioredoxin family protein similar to
           thioredoxin CH2, M-type, chloroplast precursor GB:P23400
           SP|P23400 [Chlamydomonas reinhardtii]; contains Pfam
           profile: PF00085 Thioredoxin
          Length = 172

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 11/30 (36%), Positives = 21/30 (70%), Gaps = 1/30 (3%)
 Frame = +2

Query: 131 NFETVITTTEY-ILVEFYAPWCGHCKSLAP 217
           +FE ++  ++  +LV++YA WCG C+ + P
Sbjct: 72  SFEDLLVNSDKPVLVDYYATWCGPCQFMVP 101



 Score = 32.7 bits (71), Expect = 0.34
 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
 Frame = +1

Query: 253 RSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 402
           +  I++ K+D  +   +A  Y +   PT   F++G P D + G   A  +I
Sbjct: 111 KDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQLI 161


>At1g45145.1 68414.m05175 thioredoxin H-type 5 (TRX-H-5) (TOUL)
           identical to SP|Q39241 Thioredoxin H-type 5 (TRX-H-5)
           {Arabidopsis thaliana}; identical to cDNA (TOUL) mRNA
           for thioredoxin GI:992965
          Length = 118

 Score = 32.7 bits (71), Expect = 0.34
 Identities = 17/51 (33%), Positives = 25/51 (49%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           K+D  + Q +A+ + V   PT  F + G+ ID   G   D+I   L K  G
Sbjct: 63  KIDVDELQAVAQEFKVEAMPTFVFMKEGNIIDRVVGAAKDEINEKLMKHGG 113



 Score = 31.5 bits (68), Expect = 0.78
 Identities = 11/26 (42%), Positives = 18/26 (69%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           I+++F A WC  C+ +AP +A+ A K
Sbjct: 30  IVIDFTASWCPPCRFIAPVFAEMAKK 55


>At1g43560.1 68414.m05000 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin; similar to thioredoxin
           GI:142153 from [Synechococcus PCC6301]
          Length = 167

 Score = 32.3 bits (70), Expect = 0.44
 Identities = 10/18 (55%), Positives = 14/18 (77%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAP 217
           +LV+FYA WCG C+ + P
Sbjct: 79  VLVDFYATWCGPCQLMVP 96



 Score = 27.9 bits (59), Expect = 9.6
 Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDII 402
           I + K+D  +   LA  Y +   PT   F++G   D + G   A+ ++
Sbjct: 109 IAVVKIDTEKYPSLANKYQIEALPTFILFKDGKLWDRFEGALPANQLV 156


>At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to
           tetratricoredoxin [Arabidopsis thaliana] GI:18041544;
           similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem
           sap 13 kDa protein-1) {Oryza sativa}; contains Pfam
           profile: PF00085 Thioredoxin
          Length = 380

 Score = 31.5 bits (68), Expect = 0.78
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +1

Query: 250 RRSPIKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID 369
           + S +   KVD  +  D+A S+ +   PT  F R+G  +D
Sbjct: 320 QHSRVVFLKVDIDKANDVAASWNISSVPTFCFIRDGKEVD 359



 Score = 31.1 bits (67), Expect = 1.0
 Identities = 10/26 (38%), Positives = 18/26 (69%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           +++ F A WCG C+ ++P Y+  AT+
Sbjct: 295 LILYFTATWCGPCRYMSPLYSNLATQ 320


>At4g32580.1 68417.m04638 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin
          Length = 160

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 20/60 (33%), Positives = 31/60 (51%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTGPPAVEVTSA 453
           +V+A +  +++E+Y V   P   FF++G  +D   G  AD   S L  K G  A  +T A
Sbjct: 57  RVEAEEHPEISEAYSVALVPYFVFFKDGKTVDTLEG--ADP--SSLANKVGKVAGSITPA 112


>At2g15570.1 68415.m01783 thioredoxin M-type 3, chloroplast (TRX-M3)
           identical to SP|Q9SEU7 Thioredoxin M-type 3, chloroplast
           precursor (TRX-M3) {Arabidopsis thaliana}
          Length = 173

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +2

Query: 137 ETVITTTEYILVEFYAPWCGHCK 205
           ++V+ +   +LVEFY  WCG C+
Sbjct: 78  DSVLKSETPVLVEFYTSWCGPCR 100


>At5g42980.1 68418.m05242 thioredoxin H-type 3 (TRX-H-3) (GIF1)
           identical to SP|Q42403 Thioredoxin H-type 3 (TRX-H-3)
           {Arabidopsis thaliana}; identical to cDNA (GIF1) mRNA
           for thioredoxin GI:992961
          Length = 118

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 11/26 (42%), Positives = 17/26 (65%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           I+++F A WC  C+ +AP +A  A K
Sbjct: 30  IVIDFTATWCPPCRFIAPVFADLAKK 55



 Score = 28.7 bits (61), Expect = 5.5
 Identities = 15/48 (31%), Positives = 25/48 (52%)
 Frame = +1

Query: 274 KVDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKK 417
           KVD  +   +AE + V+  PT  F + G   +   G   ++II+ L+K
Sbjct: 63  KVDVDELNTVAEEFKVQAMPTFIFMKEGEIKETVVGAAKEEIIANLEK 110


>At4g08930.1 68417.m01470 thioredoxin-related contains weak
           similarity to Swiss-Prot:Q39239 thioredoxin H-type 4
           (TRX-H-4). [Mouse-ear cress]
          Length = 295

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +1

Query: 313 YGVRGYPTLKFFRNGSPIDYSGGRQADDIISWLKKKTG 426
           YGV G+PT+    +   + Y G R  D ++++    TG
Sbjct: 124 YGVHGFPTIILMNSTMLVVYRGSRTLDSLVAFYTDVTG 161


>At3g06730.1 68416.m00798 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin
          Length = 183

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++V+FYA WCG C  +A E    A +
Sbjct: 97  LIVDFYATWCGPCILMAQELEMLAVE 122


>At1g08570.1 68414.m00950 thioredoxin family protein contains Pfam
           profile: PF00085 Thioredoxin; similar to ESTs gb|T46281,
           gb|R83933, gb|N65879, emb|F14466, gb|N96726,
           gb|AA042340, and emb|Z18150
          Length = 275

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAA 235
           ++V+F++P CG CK+L P+  + A
Sbjct: 120 VVVDFFSPGCGGCKALHPKICQFA 143


>At1g07960.3 68414.m00867 thioredoxin family protein low similarity
           to protein disulfide isomerase 4 [Giardia intestinalis]
           GI:13489047; contains Pfam profile PF00085: Thioredoxin
          Length = 146

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           I++ +VD    + +     +  YPT   F NG  +  Y G R  + + +++ ++T   A 
Sbjct: 78  IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136

Query: 439 EVTSAEQAKEL 471
           E    E  KEL
Sbjct: 137 EKAQLED-KEL 146



 Score = 28.7 bits (61), Expect = 5.5
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 211
           V+ L+   F   I   +    V+F  PWC HCK L
Sbjct: 27  VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61


>At1g07960.2 68414.m00866 thioredoxin family protein low similarity
           to protein disulfide isomerase 4 [Giardia intestinalis]
           GI:13489047; contains Pfam profile PF00085: Thioredoxin
          Length = 146

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           I++ +VD    + +     +  YPT   F NG  +  Y G R  + + +++ ++T   A 
Sbjct: 78  IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136

Query: 439 EVTSAEQAKEL 471
           E    E  KEL
Sbjct: 137 EKAQLED-KEL 146



 Score = 28.7 bits (61), Expect = 5.5
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 211
           V+ L+   F   I   +    V+F  PWC HCK L
Sbjct: 27  VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61


>At1g07960.1 68414.m00865 thioredoxin family protein low similarity
           to protein disulfide isomerase 4 [Giardia intestinalis]
           GI:13489047; contains Pfam profile PF00085: Thioredoxin
          Length = 146

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%)
 Frame = +1

Query: 262 IKLAKVDATQEQDLAESYGVRGYPTLKFFRNGSPID-YSGGRQADDIISWLKKKTGPPAV 438
           I++ +VD    + +     +  YPT   F NG  +  Y G R  + + +++ ++T   A 
Sbjct: 78  IEVGEVDCGTSRAVCTKVEIHSYPTFMLFYNGEEVSKYKGKRDVESLKAFVVEET-EKAA 136

Query: 439 EVTSAEQAKEL 471
           E    E  KEL
Sbjct: 137 EKAQLED-KEL 146



 Score = 28.7 bits (61), Expect = 5.5
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)
 Frame = +2

Query: 110 VLVLSKANFETVITTTEYI-LVEFYAPWCGHCKSL 211
           V+ L+   F   I   +    V+F  PWC HCK L
Sbjct: 27  VITLTPETFSDKIKEKDTAWFVKFCVPWCKHCKKL 61


>At3g08710.1 68416.m01012 thioredoxin family protein similar to
           thioredoxin H-type GB:P29448 SP|P29448 [Arabidopsis
           thaliana], Thioredoxin H-type 2 (TRX-H2) SP|Q07090
           {Nicotiana tabacum}; contains Pfam profile: PF00085
           Thioredoxin
          Length = 140

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 10/26 (38%), Positives = 16/26 (61%)
 Frame = +2

Query: 164 ILVEFYAPWCGHCKSLAPEYAKAATK 241
           ++  F A WCG CK +AP + + + K
Sbjct: 48  VVANFSATWCGPCKIVAPFFIELSEK 73


>At1g52990.1 68414.m05997 thioredoxin family protein similar to
           SP|P48384 Thioredoxin M-type, chloroplast precursor
           (TRX-M) {Pisum sativum}; contains Pfam profile PF00085:
           Thioredoxin
          Length = 313

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 11/33 (33%), Positives = 18/33 (54%)
 Frame = +2

Query: 155 TEYILVEFYAPWCGHCKSLAPEYAKAATKLAEE 253
           T +++V F A WCG C+ + P   K  ++   E
Sbjct: 227 TPHVMVMFTARWCGPCRDMIPILNKMDSEYKNE 259


>At2g24610.1 68415.m02940 cyclic nucleotide-regulated ion channel,
           putative (CNGC14) similar to cyclic nucleotide and
           calmodulin-regulated ion channel (GI:4581205)
           [Arabidopsis thaliana]
          Length = 726

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 14/35 (40%), Positives = 22/35 (62%)
 Frame = +3

Query: 480 QYCYCIWFLLDQSSARAKTFLSTAQVVDDQVFAIV 584
           +Y YC+WF L   S+  +  LST+  V + +FAI+
Sbjct: 349 KYLYCLWFGLQNLSSYGQN-LSTSTSVLETMFAIL 382


>At1g11530.1 68414.m01324 thioredoxin family protein similar to
           thioredoxin H-type from Arabidopsis thaliana SP|P29448,
           Nicotiana tabacum SP|Q07090; contains Pfam profile:
           PF00085 Thioredoxin
          Length = 118

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +1

Query: 277 VDATQEQDLAESYGVRGYPTLKFFRNGSPIDYSGGRQADDI 399
           VD  + +++A    V+  PT  F ++G+ +D   G   D+I
Sbjct: 61  VDVDEVKEVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEI 101


>At4g30360.1 68417.m04314 cyclic nucleotide-regulated ion channel,
           putative (CNGC17) similar to cyclic nucleotide and
           calmodulin-regulated ion channel cngc5 GI:4581205 from
           [Arabidopsis thaliana]
          Length = 720

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = +3

Query: 480 QYCYCIWFLLDQSSARAKTFLSTAQVVDDQVFAIV 584
           +Y YC+W+ L Q S+  +  LST   + +  FA++
Sbjct: 349 RYFYCLWWGLQQLSSYGQN-LSTTMFMGETTFAVL 382


>At4g16140.1 68417.m02445 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 164

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 11/34 (32%), Positives = 19/34 (55%)
 Frame = -3

Query: 476 SISSLACSAEVTSTAGGPVFFFSQLMMSSA*RPP 375
           S ++ AC    +S+ GGP +++     S + RPP
Sbjct: 60  SPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPP 93


>At1g49900.1 68414.m05596 zinc finger (C2H2 type) family protein
           contains Pfam profile: PF00096 zinc finger, C2H2 type
          Length = 917

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 585 SDEKVIKELEAEDEDVVLFKNFEEKRVKYXDEE 683
           SD   ++ +  E+ED VLF+ + + R+K  D E
Sbjct: 520 SDHGNVESIRLEEEDAVLFEPWLKSRLKSRDRE 552


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,628,255
Number of Sequences: 28952
Number of extensions: 379966
Number of successful extensions: 1145
Number of sequences better than 10.0: 62
Number of HSP's better than 10.0 without gapping: 1041
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1133
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2090971320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -