SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30165.Seq
         (897 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g08970.4 68414.m01000 CCAAT-box binding transcription factor ...   104   7e-23
At1g08970.3 68414.m00999 CCAAT-box binding transcription factor ...   104   7e-23
At1g08970.2 68414.m00998 CCAAT-box binding transcription factor ...   104   7e-23
At1g08970.1 68414.m00997 CCAAT-box binding transcription factor ...   104   7e-23
At1g54830.3 68414.m06253 CCAAT-box binding transcription factor ...   103   2e-22
At1g54830.2 68414.m06252 CCAAT-box binding transcription factor ...   103   2e-22
At1g54830.1 68414.m06251 CCAAT-box binding transcription factor ...   103   2e-22
At1g56170.1 68414.m06454 transcription factor, putative similar ...   102   3e-22
At5g63470.1 68418.m07968 CCAAT-box binding transcription factor ...   101   9e-22
At3g48590.1 68416.m05305 CCAAT-box binding transcription factor ...   100   1e-21
At5g50480.1 68418.m06252 CCAAT-box binding transcription factor ...    81   1e-15
At5g27910.1 68418.m03352 CCAAT-box binding transcription factor ...    81   1e-15
At5g50490.1 68418.m06254 CCAAT-box binding transcription factor ...    72   6e-13
At5g50470.1 68418.m06250 CCAAT-box binding transcription factor ...    72   6e-13
At5g38140.1 68418.m04596 histone-like transcription factor (CBF/...    68   1e-11
At3g12480.1 68416.m01553 transcription factor, putative                45   6e-05
At5g43250.1 68418.m05285 transcription factor, putative similar ...    41   0.001
At1g60440.1 68414.m06804 eukaryotic pantothenate kinase family p...    29   3.2  
At3g09580.1 68416.m01138 amine oxidase family protein low simila...    29   5.5  
At3g54670.1 68416.m06049 structural maintenance of chromosomes (...    28   7.3  
At3g02660.1 68416.m00257 tRNA synthetase class I (W and Y) famil...    28   9.7  
At1g61690.1 68414.m06958 tetratricopeptide repeat (TPR)-containi...    28   9.7  

>At1g08970.4 68414.m01000 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 231

 Score =  104 bits (250), Expect = 7e-23
 Identities = 50/77 (64%), Positives = 62/77 (80%)
 Frame = +1

Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEI 465
           AQ LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+
Sbjct: 56  AQQLQAFWENQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEM 113

Query: 466 FIHELTLRAWSHTEEIK 516
           FI ELTLR+W+HTEE K
Sbjct: 114 FILELTLRSWNHTEENK 130



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           ++ ++D FDFL+DIVPR +++
Sbjct: 142 AVTRTDIFDFLVDIVPREDLR 162


>At1g08970.3 68414.m00999 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 231

 Score =  104 bits (250), Expect = 7e-23
 Identities = 50/77 (64%), Positives = 62/77 (80%)
 Frame = +1

Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEI 465
           AQ LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+
Sbjct: 56  AQQLQAFWENQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEM 113

Query: 466 FIHELTLRAWSHTEEIK 516
           FI ELTLR+W+HTEE K
Sbjct: 114 FILELTLRSWNHTEENK 130



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           ++ ++D FDFL+DIVPR +++
Sbjct: 142 AVTRTDIFDFLVDIVPREDLR 162


>At1g08970.2 68414.m00998 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 231

 Score =  104 bits (250), Expect = 7e-23
 Identities = 50/77 (64%), Positives = 62/77 (80%)
 Frame = +1

Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEI 465
           AQ LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+
Sbjct: 56  AQQLQAFWENQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEM 113

Query: 466 FIHELTLRAWSHTEEIK 516
           FI ELTLR+W+HTEE K
Sbjct: 114 FILELTLRSWNHTEENK 130



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           ++ ++D FDFL+DIVPR +++
Sbjct: 142 AVTRTDIFDFLVDIVPREDLR 162


>At1g08970.1 68414.m00997 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 231

 Score =  104 bits (250), Expect = 7e-23
 Identities = 50/77 (64%), Positives = 62/77 (80%)
 Frame = +1

Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEI 465
           AQ LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+
Sbjct: 56  AQQLQAFWENQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEM 113

Query: 466 FIHELTLRAWSHTEEIK 516
           FI ELTLR+W+HTEE K
Sbjct: 114 FILELTLRSWNHTEENK 130



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           ++ ++D FDFL+DIVPR +++
Sbjct: 142 AVTRTDIFDFLVDIVPREDLR 162


>At1g54830.3 68414.m06253 CCAAT-box binding transcription factor
           Hap5a, putative similar to heme activated protein
           GI:6289057 from (Arabidopsis thaliana) GI:14577940
           CCAAT-binding protein subunit HAP5 {Hypocrea jecorina}
           similar to Transcription factor GB:CAA74053 GI:2398533
           from [Arabidopsis thaliana] similarity to transcription
           factor Hap5a similar to transcription factor Hap5a
           [Arabidopsis thaliana](GI:6523090)
          Length = 217

 Score =  103 bits (246), Expect = 2e-22
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+F
Sbjct: 47  QQLQSFWETQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMF 104

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLR+W+HTEE K
Sbjct: 105 ILELTLRSWNHTEENK 120



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           ++ ++D FDFL+DIVPR +++
Sbjct: 132 AVTRTDIFDFLVDIVPREDLR 152


>At1g54830.2 68414.m06252 CCAAT-box binding transcription factor
           Hap5a, putative similar to heme activated protein
           GI:6289057 from (Arabidopsis thaliana) GI:14577940
           CCAAT-binding protein subunit HAP5 {Hypocrea jecorina}
           similar to Transcription factor GB:CAA74053 GI:2398533
           from [Arabidopsis thaliana] similarity to transcription
           factor Hap5a similar to transcription factor Hap5a
           [Arabidopsis thaliana](GI:6523090)
          Length = 217

 Score =  103 bits (246), Expect = 2e-22
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+F
Sbjct: 47  QQLQSFWETQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMF 104

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLR+W+HTEE K
Sbjct: 105 ILELTLRSWNHTEENK 120



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           ++ ++D FDFL+DIVPR +++
Sbjct: 132 AVTRTDIFDFLVDIVPREDLR 152


>At1g54830.1 68414.m06251 CCAAT-box binding transcription factor
           Hap5a, putative similar to heme activated protein
           GI:6289057 from (Arabidopsis thaliana) GI:14577940
           CCAAT-binding protein subunit HAP5 {Hypocrea jecorina}
           similar to Transcription factor GB:CAA74053 GI:2398533
           from [Arabidopsis thaliana] similarity to transcription
           factor Hap5a similar to transcription factor Hap5a
           [Arabidopsis thaliana](GI:6523090)
          Length = 217

 Score =  103 bits (246), Expect = 2e-22
 Identities = 49/76 (64%), Positives = 61/76 (80%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW+   ++I+K    DFK  +LPLARIKKIMK DE+V+MISAEAPV+FA+A E+F
Sbjct: 47  QQLQSFWETQFKEIEKTT--DFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMF 104

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLR+W+HTEE K
Sbjct: 105 ILELTLRSWNHTEENK 120



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 10/21 (47%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           ++ ++D FDFL+DIVPR +++
Sbjct: 132 AVTRTDIFDFLVDIVPREDLR 152


>At1g56170.1 68414.m06454 transcription factor, putative similar to
           Transcription factor GB:CAA74053 GI:2398533 from
           [Arabidopsis thaliana] similarity to transcription
           factor Hap5a similar to transcription factor Hap5a
           [Arabidopsis thaliana](GI:6523090)
          Length = 199

 Score =  102 bits (245), Expect = 3e-22
 Identities = 50/76 (65%), Positives = 60/76 (78%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW   +++I+  ++ DFK   LPLARIKKIMK DE+V+MISAEAPV+FAKA E+F
Sbjct: 53  QQLQMFWANQMQEIE--HTTDFKNHTLPLARIKKIMKADEDVRMISAEAPVIFAKACEMF 110

Query: 469 IHELTLRAWSHTEEIK 516
           I ELTLRAW HTEE K
Sbjct: 111 ILELTLRAWIHTEENK 126



 Score = 32.3 bits (70), Expect = 0.45
 Identities = 12/21 (57%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I ++D FDFL+DI+PR E+K
Sbjct: 138 AISRTDVFDFLVDIIPRDELK 158


>At5g63470.1 68418.m07968 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 250

 Score =  101 bits (241), Expect = 9e-22
 Identities = 49/76 (64%), Positives = 59/76 (77%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW    ++I++VN  DFK   LPLARIKKIMK DE+V+MISAEAP+LFAKA E+F
Sbjct: 55  QQLQMFWTYQRQEIEQVN--DFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELF 112

Query: 469 IHELTLRAWSHTEEIK 516
           I ELT+R+W H EE K
Sbjct: 113 ILELTIRSWLHAEENK 128



 Score = 33.9 bits (74), Expect = 0.15
 Identities = 13/21 (61%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I ++D FDFL+DIVPR E+K
Sbjct: 140 AITRTDIFDFLVDIVPREEIK 160



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +3

Query: 441 LIREGC*DFYTRANVASLVAYGGNKRRTLQRNDIA 545
           L  + C  F     + S +    NKRRTLQ+NDIA
Sbjct: 104 LFAKACELFILELTIRSWLHAEENKRRTLQKNDIA 138


>At3g48590.1 68416.m05305 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 234

 Score =  100 bits (239), Expect = 1e-21
 Identities = 49/76 (64%), Positives = 59/76 (77%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           Q LQ FW    ++I++VN  DFK   LPLARIKKIMK DE+V+MISAEAP+LFAKA E+F
Sbjct: 42  QQLQLFWTYQRQEIEQVN--DFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELF 99

Query: 469 IHELTLRAWSHTEEIK 516
           I ELT+R+W H EE K
Sbjct: 100 ILELTIRSWLHAEENK 115



 Score = 33.5 bits (73), Expect = 0.19
 Identities = 13/21 (61%), Positives = 18/21 (85%)
 Frame = +2

Query: 548 SILKSDQFDFLIDIVPRHEVK 610
           +I ++D FDFL+DIVPR E+K
Sbjct: 127 AITRTDIFDFLVDIVPRDEIK 147



 Score = 29.1 bits (62), Expect = 4.2
 Identities = 15/35 (42%), Positives = 19/35 (54%)
 Frame = +3

Query: 441 LIREGC*DFYTRANVASLVAYGGNKRRTLQRNDIA 545
           L  + C  F     + S +    NKRRTLQ+NDIA
Sbjct: 91  LFAKACELFILELTIRSWLHAEENKRRTLQKNDIA 125


>At5g50480.1 68418.m06252 CCAAT-box binding transcription factor
           Hap5a, putative GI:14577940 CCAAT-binding protein
           subunit HAP5 {Hypocrea jecorina} similar to
           Transcription factor GB:CAA74053 GI:2398533 from
           [Arabidopsis thaliana] similarity to transcription
           factor Hap5a similar to transcription factor Hap5a
           [Arabidopsis thaliana](GI:6523090)
          Length = 202

 Score = 81.0 bits (191), Expect = 1e-15
 Identities = 39/74 (52%), Positives = 53/74 (71%)
 Frame = +1

Query: 295 LQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIH 474
           L+ +W + +E +      DFK + LPLARIKKIMK D +V M+SAEAP++FAKA E+FI 
Sbjct: 36  LRNYWIEQMETVS-----DFKNRQLPLARIKKIMKADPDVHMVSAEAPIIFAKACEMFIV 90

Query: 475 ELTLRAWSHTEEIK 516
           +LT+R+W   EE K
Sbjct: 91  DLTMRSWLKAEENK 104


>At5g27910.1 68418.m03352 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 187

 Score = 80.6 bits (190), Expect = 1e-15
 Identities = 38/78 (48%), Positives = 53/78 (67%)
 Frame = +1

Query: 283 GAQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAE 462
           G + L+ FW K +E      + DFK   LP+ RIKKIMK D +V MI++EAP+L +KA E
Sbjct: 14  GNEQLKSFWSKEME-----GNLDFKNHDLPITRIKKIMKYDPDVTMIASEAPILLSKACE 68

Query: 463 IFIHELTLRAWSHTEEIK 516
           +FI +LT+R+W H +E K
Sbjct: 69  MFIMDLTMRSWLHAQESK 86


>At5g50490.1 68418.m06254 CCAAT-box binding transcription factor
           Hap5a, putative
          Length = 186

 Score = 71.7 bits (168), Expect = 6e-13
 Identities = 33/74 (44%), Positives = 50/74 (67%)
 Frame = +1

Query: 289 QTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIF 468
           + L+ FW K +E    V + +F     P++RIK+IMK D +V MI+AEAP L +KA E+F
Sbjct: 16  EQLKSFWSKGMEGDLNVKNHEF-----PISRIKRIMKFDPDVSMIAAEAPNLLSKACEMF 70

Query: 469 IHELTLRAWSHTEE 510
           + +LT+R+W H +E
Sbjct: 71  VMDLTMRSWLHAQE 84


>At5g50470.1 68418.m06250 CCAAT-box binding transcription factor
           Hap5a, putative contains similarity to GI:14577940
           CCAAT-binding protein subunit HAP5 {Hypocrea jecorina}
          Length = 212

 Score = 71.7 bits (168), Expect = 6e-13
 Identities = 34/60 (56%), Positives = 43/60 (71%)
 Frame = +1

Query: 331 QKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           Q  N+ D K  A PL RIKKIMK + EV M++AEAPVL +KA E+ I +LT+R+W HT E
Sbjct: 52  QMGNATDVKHHAFPLTRIKKIMKSNPEVNMVTAEAPVLISKACEMLILDLTMRSWLHTVE 111


>At5g38140.1 68418.m04596 histone-like transcription factor
           (CBF/NF-Y) family protein similar to CCAAT-binding
           transcription factor subunit AAB-1 (GI:2583171)
           [Neurospora crassa];  contains a CBF/NF-Y subunit
           signature (PDOC00578) presernt in members of
           histone-like transcription factor family; contains Pfam
           PF00808 : Histone-like transcription factor (CBF/NF-Y)
           and archaeal histone
          Length = 195

 Score = 67.7 bits (158), Expect = 1e-11
 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 1/66 (1%)
 Frame = +1

Query: 313 KVLEDIQKVNSEDFKTQA-LPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLR 489
           KV  + Q+    +F  Q  LPL+R++KI+K D EVK IS + P LF+KA E FI E+TLR
Sbjct: 49  KVFWNNQREQLGNFAGQTHLPLSRVRKILKSDPEVKKISCDVPALFSKACEYFILEVTLR 108

Query: 490 AWSHTE 507
           AW HT+
Sbjct: 109 AWMHTQ 114


>At3g12480.1 68416.m01553 transcription factor, putative
          Length = 293

 Score = 45.2 bits (102), Expect = 6e-05
 Identities = 22/47 (46%), Positives = 31/47 (65%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEE 510
           P ARIKKIM+ DE+V  I+   PVL +K+ E+F+ +L  R +  T E
Sbjct: 10  PAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLE 56


>At5g43250.1 68418.m05285 transcription factor, putative similar to
           heme activated protein GI:6289057 from (Arabidopsis
           thaliana) GI:14577940 CCAAT-binding protein subunit HAP5
           {Hypocrea jecorina} similar to Transcription factor
           GB:CAA74053 GI:2398533 from [Arabidopsis thaliana]
           similarity to transcription factor Hap5a similar to
           transcription factor Hap5a [Arabidopsis
           thaliana](GI:6523090)
          Length = 130

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 19/49 (38%), Positives = 32/49 (65%)
 Frame = +1

Query: 370 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEEIK 516
           P+ R+KKIMKLD+++  I++EA  +   + E+F+H L  ++   T E K
Sbjct: 13  PIGRVKKIMKLDKDINKINSEALHVITYSTELFLHFLAEKSAVVTAEKK 61


>At1g60440.1 68414.m06804 eukaryotic pantothenate kinase family
           protein similar to pantothenate kinase GI:4191500 from
           [Aspergillus nidulans]; contains Pfam profile PF03630:
           Fumble
          Length = 383

 Score = 29.5 bits (63), Expect = 3.2
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = -2

Query: 254 ISVHFFGRGNRRCLFGRHKEAHGHFVVFSTNFTRQTH 144
           ++VHF+ RG  + +F RH+   G    F T++  Q+H
Sbjct: 304 VAVHFWSRGEAKAMFLRHEGFLGALGAF-TSYNDQSH 339


>At3g09580.1 68416.m01138 amine oxidase family protein low
           similarity to SP|P28553 Phytoene dehydrogenase,
           chloroplast precursor (Phytoene desaturase) from Glycine
           max; contains Pfam profile PF01593 amine oxidase,
           flavin-containing
          Length = 477

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 16/53 (30%), Positives = 25/53 (47%)
 Frame = +1

Query: 286 AQTLQQFWDKVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEVKMISAEAPVL 444
           A  L+ FWD V      + S   K   + L R + ++K DEE+   + E P +
Sbjct: 139 ADPLRHFWDSVASLANPIGSVVDKG-LIALTRARVLIKSDEEILTAADEVPTI 190


>At3g54670.1 68416.m06049 structural maintenance of chromosomes
           (SMC) family protein similar to SMC1 protein [Bos
           taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC
           protein) [Xenopus laevis] GI:3328231; contains Pfam
           profiles PF02483: SMC family C-terminal domain, PF02463:
           RecF/RecN/SMC N terminal domain
          Length = 1257

 Score = 28.3 bits (60), Expect = 7.3
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +1

Query: 280 GGAQTLQQFWD-KVLEDIQKVNSEDFKTQALPLARIKKIMKLDEEV--KMISAEAPVLFA 450
           GG +     WD K +E ++K N EDF+ Q   +  I+++   + E+  K+   E  + +A
Sbjct: 682 GGMEAKSNKWDDKKIEGLKK-NKEDFEQQLENIGSIREMQMKESEISGKISGLEKKIQYA 740

Query: 451 K 453
           +
Sbjct: 741 E 741


>At3g02660.1 68416.m00257 tRNA synthetase class I (W and Y) family
           protein similar to SP|P00952 Tyrosyl-tRNA synthetase (EC
           6.1.1.1) (Tyrosine--tRNA ligase) (TyrRS) {Bacillus
           stearothermophilus}; contains Pfam profiles PF00579:
           tRNA synthetases class I (W and Y), PF01479: S4 domain
          Length = 511

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 3/73 (4%)
 Frame = +3

Query: 237 EEVDADLPVRSPPLRRRTNPPAVLGQSLRGHTES*F---RRLQDPSFAVGSHQEDHETRR 407
           E +  D+P  S P+ R +    V      G  ES     R L+   F + + + D E +R
Sbjct: 425 ERIAEDIPSCSLPIDRVSGLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKR 484

Query: 408 GGEDDISRGTGLI 446
             E+DI  G GL+
Sbjct: 485 VDEEDIVEGRGLV 497


>At1g61690.1 68414.m06958 tetratricopeptide repeat (TPR)-containing
            protein contains Pfam profile PF00515: TPR Domain
          Length = 1155

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +1

Query: 352  FKTQALPLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELT 483
            FK Q   L+  ++ MKL  E KM  AEA    AK  E  + + T
Sbjct: 1001 FKLQQESLSHKRQAMKLRREGKMQEAEAEFEIAKTLEAQLEDST 1044


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,810,035
Number of Sequences: 28952
Number of extensions: 314902
Number of successful extensions: 819
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 770
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 819
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2110422216
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -