SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30164.Seq
         (888 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g03340.1 68418.m00286 cell division cycle protein 48, putativ...   140   1e-33
At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)...   139   2e-33
At3g53230.1 68416.m05865 cell division cycle protein 48, putativ...   134   7e-32
At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1...    31   1.0  
At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak...    31   1.4  
At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containi...    30   1.8  
At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, puta...    29   4.1  

>At5g03340.1 68418.m00286 cell division cycle protein 48, putative /
           CDC48, putative very strong similarity to SP|P54609 Cell
           division cycle protein 48 homolog {Arabidopsis
           thaliana}; contains Pfam profiles PF00004: ATPase AAA
           family, PF02359: Cell division protein 48 (CDC48)
           N-terminal domain; supporting cDNA
           gi|26449351|dbj|AK117125.1|
          Length = 810

 Score =  140 bits (338), Expect = 1e-33
 Identities = 91/224 (40%), Positives = 121/224 (54%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CI L+D+ C + KIRM             DV+S+  CP VKYGKRVHIL
Sbjct: 62  LIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHIL 121

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           P+DD+VEG+TGNLF+ YLKPYF+EAYRP+ + D F   G      S   K I    A + 
Sbjct: 122 PVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRGG---MRSVEFKVIETDPAEYC 178

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           ++   T         K+     L  +    V  V    AQI+E+VELPLR    + + + 
Sbjct: 179 VVAPDTEIFCEGEPVKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHP-QLFKSIG 237

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K P+GIL ++G   +GK T     +  ETGA  F INGP IMS
Sbjct: 238 VKPPKGIL-LYGPPGSGK-TLIARAVANETGAFFFCINGPEIMS 279



 Score =  109 bits (261), Expect = 3e-24
 Identities = 61/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 158 VRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDEER-LDEVGYDDVGGVRKQM 216

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FK+IGVK   +     GPP + K   +ARAVAN    FF
Sbjct: 217 AQ---IRELVELPLRHPQLFKSIGVK-PPKGILLYGPPGSGKT-LIARAVANETGAFF 269



 Score = 93.9 bits (223), Expect = 1e-19
 Identities = 42/65 (64%), Positives = 55/65 (84%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           +D+K+  D STAIL RK  PNRL+V+EA++DDNSVV+L    ME+LQLFRGDT+L+KGK+
Sbjct: 8   SDSKTKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKK 67

Query: 242 RKETV 256
           RK+TV
Sbjct: 68  RKDTV 72


>At3g09840.1 68416.m01174 cell division cycle protein 48 (CDC48A)
           (CDC48) identical to SP|P54609 Cell division cycle
           protein 48 homolog {Arabidopsis thaliana}
          Length = 809

 Score =  139 bits (337), Expect = 2e-33
 Identities = 91/224 (40%), Positives = 121/224 (54%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CI L+D+ C + KIRM             DV+S+  CP VKYGKRVHIL
Sbjct: 62  LIKGKKRKDTVCIALADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHIL 121

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           P+DD+VEG+TGNLF+ YLKPYF+EAYRP+ + D F   G      S   K I    A + 
Sbjct: 122 PVDDTVEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRGG---MRSVEFKVIETDPAEYC 178

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           ++   T         K+     L  +    V  V    AQI+E+VELPLR    + + + 
Sbjct: 179 VVAPDTEIFCEGEPVKREDEERLDDVGYDDVGGVRKQMAQIRELVELPLRHP-QLFKSIG 237

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K P+GIL ++G   +GK T     +  ETGA  F INGP IMS
Sbjct: 238 VKPPKGIL-LYGPPGSGK-TLIARAVANETGAFFFCINGPEIMS 279



 Score =  108 bits (260), Expect = 4e-24
 Identities = 61/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMR+VEFKV+ETDP+ +C+VAPDT I C+GEP+KRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 158 VRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKREDEER-LDDVGYDDVGGVRKQM 216

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FK+IGVK   +     GPP + K   +ARAVAN    FF
Sbjct: 217 AQ---IRELVELPLRHPQLFKSIGVK-PPKGILLYGPPGSGKT-LIARAVANETGAFF 269



 Score = 96.7 bits (230), Expect = 2e-20
 Identities = 44/65 (67%), Positives = 56/65 (86%)
 Frame = +2

Query: 62  ADNKSPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGKR 241
           +D+KS  D STAIL RK  PNRL+V+EA++DDNSVV+L  A ME+LQLFRGDT+L+KGK+
Sbjct: 8   SDSKSKKDFSTAILERKKSPNRLVVDEAINDDNSVVSLHPATMEKLQLFRGDTILIKGKK 67

Query: 242 RKETV 256
           RK+TV
Sbjct: 68  RKDTV 72


>At3g53230.1 68416.m05865 cell division cycle protein 48, putative /
           CDC48, putative very strong similarity to SP|P54609 Cell
           division cycle protein 48 homolog {Arabidopsis
           thaliana}; contains Pfam profiles PF00004: ATPase AAA
           family, PF02359: Cell division protein 48 (CDC48)
           N-terminal domain
          Length = 815

 Score =  134 bits (324), Expect = 7e-32
 Identities = 87/224 (38%), Positives = 120/224 (53%), Gaps = 2/224 (0%)
 Frame = +1

Query: 223 LAQGQTPQGNRCIVLSDDNCPDEKIRMXXXXXXXXXXXXSDVVSIAPCPSVKYGKRVHIL 402
           L +G+  +   CI L+D+ C + KIRM             DV+S+  CP VKYG RVHIL
Sbjct: 63  LIKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVHIL 122

Query: 403 PIDDSVEGLTGNLFEVYLKPYFMEAYRPIHRDDTFRSAGACAPSSSKWSKQIHHHFASWL 582
           P+DD++EG++GN+F+ YLKPYF+EAYRP+ + D F   G      S   K I    A + 
Sbjct: 123 PLDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLVRGG---MRSIEFKVIETDPAEYC 179

Query: 583 LIP*YTVTVNRLNVRKKRKH*MLSAMMTSAV--VANNWAQIKEMVELPLRSSFTVSRLLE 756
           ++   T         K+     L  +    V  V    AQI+E+VELPLR    + + + 
Sbjct: 180 VVAPDTEIFCEGEPIKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHP-QLFKSIG 238

Query: 757 *KLPRGILHVWGRLVTGKNTHWLVLLLMETGASSFLINGPGIMS 888
            K P+GIL ++G   +GK T     +  ETGA  F INGP IMS
Sbjct: 239 VKPPKGIL-LYGPPGSGK-TLIARAVANETGAFFFCINGPEIMS 280



 Score =  109 bits (261), Expect = 3e-24
 Identities = 61/118 (51%), Positives = 78/118 (66%), Gaps = 2/118 (1%)
 Frame = +3

Query: 510 VRGGMRAVEFKVVETDPSPFCIVAPDTVIHCDGEPIKREEEEEALNAVGYDDIGGCRKQL 689
           VRGGMR++EFKV+ETDP+ +C+VAPDT I C+GEPIKRE+EE  L+ VGYDD+GG RKQ+
Sbjct: 159 VRGGMRSIEFKVIETDPAEYCVVAPDTEIFCEGEPIKREDEER-LDEVGYDDVGGVRKQM 217

Query: 690 GAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARAVANGNRGFF 857
                   +    + H   FK+IGVK   +     GPP + K   +ARAVAN    FF
Sbjct: 218 AQ---IRELVELPLRHPQLFKSIGVK-PPKGILLYGPPGSGKT-LIARAVANETGAFF 270



 Score = 84.2 bits (199), Expect = 1e-16
 Identities = 40/66 (60%), Positives = 54/66 (81%), Gaps = 1/66 (1%)
 Frame = +2

Query: 62  ADNK-SPDDLSTAILRRKDRPNRLIVEEAVSDDNSVVALSQAKMEQLQLFRGDTVLLKGK 238
           +D+K +  D STAIL +K   NRL+V+EA++DDNSVV+L    ME+LQLFRGDT+L+KGK
Sbjct: 8   SDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGDTILIKGK 67

Query: 239 RRKETV 256
           +RK+TV
Sbjct: 68  KRKDTV 73


>At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1a)
           similar to 26S proteasome ATPase subunit GI:1395190 from
           [Spinacia oleracea]
          Length = 426

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 2/72 (2%)
 Frame = +3

Query: 651 VGYDDIGGCRKQLGAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLA 824
           V Y+D+GGC++Q+        V    +LH   F  +G+    +   C GPP   K   LA
Sbjct: 165 VTYNDVGGCKEQIEKM---REVVELPMLHPEKFVKLGID-PPKGVLCYGPPGTGKT-LLA 219

Query: 825 RAVANGNRGFFL 860
           RAVAN     F+
Sbjct: 220 RAVANRTDACFI 231


>At4g13885.1 68417.m02151 3'-5' exonuclease-related contains weak
           similarity to Pfam domain PF01612: 3'-5' exonuclease
          Length = 263

 Score = 30.7 bits (66), Expect = 1.4
 Identities = 13/23 (56%), Positives = 18/23 (78%)
 Frame = -3

Query: 214 TTEELKLLHFGL*KCHD*VVIAD 146
           TTEELK+ H+ L KC D +V+A+
Sbjct: 3   TTEELKISHYKLYKCFDFLVVAN 25


>At3g26630.1 68416.m03328 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile: PF01535 PPR repeat
          Length = 455

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 11/32 (34%), Positives = 20/32 (62%)
 Frame = -1

Query: 369 RTRSDGYHIRKTHTKVVSHNTVHPNFLIRAII 274
           RT S+   +++ HTK++ HN  +   L+R +I
Sbjct: 28  RTCSNFSQLKQIHTKIIKHNLTNDQLLVRQLI 59


>At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit,
           putative similar to  26S proteasome AAA-ATPase subunit
           RPT1 SP:Q41365 from [Spinacia oleracea]
          Length = 464

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 2/70 (2%)
 Frame = +3

Query: 657 YDDIGGCRKQLGAN*GDGGVATAVILH--CFKAIGVKASTRHSPCMGPPXNRKKHSLARA 830
           Y DIGGC++Q+        V    +LH   F  +G+    +   C GPP + K   +ARA
Sbjct: 204 YSDIGGCKEQIEK---IREVVELPMLHPEKFVRLGID-PPKGVLCYGPPGSGKT-LVARA 258

Query: 831 VANGNRGFFL 860
           VAN     F+
Sbjct: 259 VANRTGACFI 268


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 20,258,071
Number of Sequences: 28952
Number of extensions: 429801
Number of successful extensions: 1212
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1162
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1203
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2081245872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -