SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30163.Seq
         (824 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g36020.1 68417.m05128 cold-shock DNA-binding family protein c...    42   4e-04
At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c...    42   7e-04
At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c...    39   0.004
At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /...    39   0.005
At2g33620.3 68415.m04122 DNA-binding family protein / AT-hook pr...    30   1.6  
At2g33620.2 68415.m04121 DNA-binding family protein / AT-hook pr...    30   1.6  
At2g33620.1 68415.m04120 DNA-binding family protein / AT-hook pr...    30   1.6  
At3g45830.1 68416.m04960 expressed protein                             29   2.8  
At1g25540.1 68414.m03171 phytochrome and flowering time regulato...    28   6.5  

>At4g36020.1 68417.m05128 cold-shock DNA-binding family protein
           contains Pfam domains, PF00313: 'Cold-shock' DNA-binding
           domain and PF00098: Zinc knuckle
          Length = 299

 Score = 42.3 bits (95), Expect = 4e-04
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 1/62 (1%)
 Frame = +1

Query: 241 FHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKG-FEAAGVTGPGGEP 417
           F   DD   ++FVHQ++I      +  RS+  G+AVEFA+  G  G  +A  VT PGG  
Sbjct: 26  FITPDDGSVELFVHQSSIVS----EGYRSLTVGDAVEFAITQGSDGKTKAVNVTAPGGGS 81

Query: 418 VK 423
           +K
Sbjct: 82  LK 83



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 11/20 (55%), Positives = 13/20 (65%)
 Frame = +2

Query: 188 AEKVSGTVKWFNVKSGYGFI 247
           A + +G V WFN   GYGFI
Sbjct: 8   AARSTGKVNWFNASKGYGFI 27


>At4g38680.1 68417.m05477 cold-shock DNA-binding family protein
           contains Pfam domains PF00313: 'Cold-shock' DNA-binding
           domain and PF00098: Zinc knuckle
          Length = 203

 Score = 41.5 bits (93), Expect = 7e-04
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 1/77 (1%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAV-VAGEKG 378
           G  +    Q+   F   DD  +D+FVHQ++I      +  RS+   EAVEF V +     
Sbjct: 13  GSVKWFDTQKGFGFITPDDGGDDLFVHQSSIR----SEGFRSLAAEEAVEFEVEIDNNNR 68

Query: 379 FEAAGVTGPGGEPVKGS 429
            +A  V+GP G PV+G+
Sbjct: 69  PKAIDVSGPDGAPVQGN 85



 Score = 29.9 bits (64), Expect = 2.1
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = +2

Query: 191 EKVSGTVKWFNVKSGYGFI 247
           E+  G+VKWF+ + G+GFI
Sbjct: 9   ERRKGSVKWFDTQKGFGFI 27


>At2g17870.1 68415.m02070 cold-shock DNA-binding family protein
           contains Pfam domains, PF00313: 'Cold-shock' DNA-binding
           domain and PF00098: Zinc knuckle
          Length = 301

 Score = 39.1 bits (87), Expect = 0.004
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +1

Query: 196 SIGHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEK 375
           SIG        +   F   DD  E++FVHQ++I  +      RS+  GE+VE+ +  G  
Sbjct: 11  SIGKVSWFSDGKGYGFITPDDGGEELFVHQSSIVSD----GFRSLTLGESVEYEIALGSD 66

Query: 376 G-FEAAGVTGPGG 411
           G  +A  VT PGG
Sbjct: 67  GKTKAIEVTAPGG 79


>At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /
           glycine-rich protein (GRP2) identical to Glycine-rich
           protein 2b (AtGRP2b) [Arabidopsis thaliana]
           SWISS-PROT:Q38896; contains Pfam domains PF00313:
           'Cold-shock' DNA-binding domain and PF00098: Zinc
           knuckle
          Length = 201

 Score = 38.7 bits (86), Expect = 0.005
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 1/77 (1%)
 Frame = +1

Query: 202 GHCEMVQRQEWIWFHQQDDTKEDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGF 381
           G  +    Q+   F    D  +D+FVHQ++I      +  RS+   E+VEF V     G 
Sbjct: 17  GTVKWFDTQKGFGFITPSDGGDDLFVHQSSIR----SEGFRSLAAEESVEFDVEVDNSGR 72

Query: 382 -EAAGVTGPGGEPVKGS 429
            +A  V+GP G PV+G+
Sbjct: 73  PKAIEVSGPDGAPVQGN 89



 Score = 30.3 bits (65), Expect = 1.6
 Identities = 10/19 (52%), Positives = 15/19 (78%)
 Frame = +2

Query: 191 EKVSGTVKWFNVKSGYGFI 247
           ++  GTVKWF+ + G+GFI
Sbjct: 13  DRRKGTVKWFDTQKGFGFI 31


>At2g33620.3 68415.m04122 DNA-binding family protein / AT-hook
           protein 1 (AHP1) identical to AT-hook protein 1
           [Arabidopsis thaliana] gi|2598227|emb|CAA10857
          Length = 351

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 325 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQYFP 477
           S G+   +   +  GE G    G+TG G EPVK       KRRG  R+Y P
Sbjct: 69  SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKYGP 108


>At2g33620.2 68415.m04121 DNA-binding family protein / AT-hook
           protein 1 (AHP1) identical to AT-hook protein 1
           [Arabidopsis thaliana] gi|2598227|emb|CAA10857
          Length = 351

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 325 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQYFP 477
           S G+   +   +  GE G    G+TG G EPVK       KRRG  R+Y P
Sbjct: 69  SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKYGP 108


>At2g33620.1 68415.m04120 DNA-binding family protein / AT-hook
           protein 1 (AHP1) identical to AT-hook protein 1
           [Arabidopsis thaliana] gi|2598227|emb|CAA10857
          Length = 351

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 20/51 (39%), Positives = 25/51 (49%)
 Frame = +1

Query: 325 SVGDGEAVEFAVVAGEKGFEAAGVTGPGGEPVKGSPYAADKRRGYHRQYFP 477
           S G+   +   +  GE G    G+TG G EPVK       KRRG  R+Y P
Sbjct: 69  SAGENSVLNMNLPGGESG----GMTGTGSEPVK-------KRRGRPRKYGP 108


>At3g45830.1 68416.m04960 expressed protein
          Length = 1298

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 21/81 (25%), Positives = 35/81 (43%), Gaps = 2/81 (2%)
 Frame = +1

Query: 220  QRQEWIWFHQQDDTK--EDVFVHQTAIARNNPRKAVRSVGDGEAVEFAVVAGEKGFEAAG 393
            +R+ W++ H+  + +  ED     T   +   ++A     + EAV  A +  E+  E   
Sbjct: 1161 ERKLWVYLHRDREQEDFEDDGTSSTKKWKRPKKEAAEQTEEQEAVTVAFLGNEEQTE--- 1217

Query: 394  VTGPGGEPVKGSPYAADKRRG 456
             T  G EP  G P   D  +G
Sbjct: 1218 -TEMGSEPKTGEPTGLDGDQG 1237


>At1g25540.1 68414.m03171 phytochrome and flowering time regulatory
           protein (PFT1) PMID: 12815435
          Length = 836

 Score = 28.3 bits (60), Expect = 6.5
 Identities = 10/26 (38%), Positives = 17/26 (65%)
 Frame = +2

Query: 218 FNVKSGYGFINRMTPRKMCLCIRLPS 295
           F   S +GF+ ++  +K+C  I+LPS
Sbjct: 623 FRAMSQHGFLGQLQDKKLCAVIQLPS 648


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,860,127
Number of Sequences: 28952
Number of extensions: 225891
Number of successful extensions: 681
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 661
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 679
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1892353600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -