SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30162.Seq
         (465 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B) ribo...    95   3e-20
At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C)            92   1e-19
At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A)            91   3e-19
At4g17250.1 68417.m02594 expressed protein                             28   2.7  
At3g19400.2 68416.m02460 cysteine proteinase, putative non-conse...    27   6.2  
At3g19400.1 68416.m02461 cysteine proteinase, putative non-conse...    27   6.2  
At1g32900.1 68414.m04053 starch synthase, putative similar to st...    27   6.2  
At5g37080.1 68418.m04451 hypothetical protein includes At5g37080...    27   8.3  

>At4g26230.1 68417.m03776 60S ribosomal protein L31 (RPL31B)
           ribosomal protein L31, Nicotiana glutinosa, U23784
          Length = 119

 Score = 94.7 bits (225), Expect = 3e-20
 Identities = 43/61 (70%), Positives = 52/61 (85%)
 Frame = +2

Query: 71  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 250
           E+KG+    EVVTREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK+MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAEKEMGTKDVRVDVKLN 60

Query: 251 K 253
           K
Sbjct: 61  K 61



 Score = 44.4 bits (100), Expect = 4e-05
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 2/90 (2%)
 Frame = +1

Query: 148 CWI*KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDD 327
           C   K  PK+ +   K   K  G         L + +WSKG+R  P           NDD
Sbjct: 27  CTFKKKAPKAIKEIRKFAEKEMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDD 86

Query: 328 EDSAHKLFTLVTY--VPVASIKGLQTENVD 411
           ED+  + F+LVT   +P   + GL T+ ++
Sbjct: 87  EDAKEEFFSLVTVAEIPAEGLSGLGTKIIE 116


>At5g56710.1 68418.m07078 60S ribosomal protein L31 (RPL31C)
          Length = 119

 Score = 92.3 bits (219), Expect = 1e-19
 Identities = 42/61 (68%), Positives = 51/61 (83%)
 Frame = +2

Query: 71  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLN 250
           E+KG+    EV+TREYT+NLH+RLH   FKK+AP+AIKEIRKFAEK MGT D+RVD +LN
Sbjct: 3   EKKGRK--EEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLN 60

Query: 251 K 253
           K
Sbjct: 61  K 61



 Score = 44.8 bits (101), Expect = 3e-05
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 2/90 (2%)
 Frame = +1

Query: 148 CWI*KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDD 327
           C   K  PK+ +   K   K  G         L + +WSKG+R  P           NDD
Sbjct: 27  CTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDD 86

Query: 328 EDSAHKLFTLVTY--VPVASIKGLQTENVD 411
           ED+  + F+LVT   +P   + GL T+ ++
Sbjct: 87  EDAKEEFFSLVTVAEIPAEGLSGLGTKVIE 116


>At2g19740.1 68415.m02306 60S ribosomal protein L31 (RPL31A)
          Length = 119

 Score = 91.5 bits (217), Expect = 3e-19
 Identities = 42/59 (71%), Positives = 47/59 (79%)
 Frame = +2

Query: 77  KGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNK 253
           KGK    EVVTREYT+NLH+RLH   FKK+AP AIKEIRKFA K MGT D+RVD +LNK
Sbjct: 3   KGKGRKEEVVTREYTINLHRRLHSCTFKKKAPNAIKEIRKFALKAMGTKDVRVDVKLNK 61



 Score = 43.2 bits (97), Expect = 9e-05
 Identities = 26/93 (27%), Positives = 40/93 (43%), Gaps = 2/93 (2%)
 Frame = +1

Query: 148 CWI*KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILWSKGVRNVPFXXXXXXXXXXNDD 327
           C   K  P + +   K   K  G         L + +WSKG+R  P           NDD
Sbjct: 27  CTFKKKAPNAIKEIRKFALKAMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDD 86

Query: 328 EDSAHKLFTLVTY--VPVASIKGLQTENVDASQ 420
           ED+  + F+LVT   +P   + GL T+ ++  +
Sbjct: 87  EDAKEEFFSLVTVAEIPAEGLSGLGTKVIEEEE 119


>At4g17250.1 68417.m02594 expressed protein
          Length = 416

 Score = 28.3 bits (60), Expect = 2.7
 Identities = 13/40 (32%), Positives = 22/40 (55%)
 Frame = +2

Query: 119 TVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVD 238
           TV   KR   + +KKR   A+K+   + E++ G P ++ D
Sbjct: 169 TVPATKRFLELKYKKRYEFALKQCPSYTERRRGVPKLKED 208


>At3g19400.2 68416.m02460 cysteine proteinase, putative
           non-consensus AT acceptor site at exon 3; contains
           similarity to cysteine protease CYP1 GI:2828252, TDI-65
           GI:5726641 from [Lycopersicon esculentum]
          Length = 290

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 14/55 (25%), Positives = 25/55 (45%)
 Frame = +2

Query: 113 EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKSFGLRESE 277
           ++ V   K  +G+G K+R  +  K+  KF ++    PD   +  L +   L   E
Sbjct: 46  QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRFADLTNEE 100


>At3g19400.1 68416.m02461 cysteine proteinase, putative
           non-consensus AT acceptor site at exon 3; contains
           similarity to cysteine protease CYP1 GI:2828252, TDI-65
           GI:5726641 from [Lycopersicon esculentum]
          Length = 362

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 14/55 (25%), Positives = 25/55 (45%)
 Frame = +2

Query: 113 EYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRLNKSFGLRESE 277
           ++ V   K  +G+G K+R  +  K+  KF ++    PD   +  L +   L   E
Sbjct: 46  QWLVENRKNYNGLGEKERRFKIFKDNLKFVDEHNSVPDRTFEVGLTRFADLTNEE 100


>At1g32900.1 68414.m04053 starch synthase, putative similar to
           starch synthase SP:Q42857 from [Ipomoea batatas]
          Length = 610

 Score = 27.1 bits (57), Expect = 6.2
 Identities = 14/55 (25%), Positives = 26/55 (47%)
 Frame = +2

Query: 71  ERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRV 235
           E+KG   + E +++   +N+   + G G KK   + ++   KF  K +G     V
Sbjct: 412 EQKGSDILVEAISKFMGLNVQMVILGTGKKKMEAQILELEEKFPGKAVGVAKFNV 466


>At5g37080.1 68418.m04451 hypothetical protein includes At5g37080,
           At5g37170, At2g05090
          Length = 566

 Score = 26.6 bits (56), Expect = 8.3
 Identities = 13/45 (28%), Positives = 20/45 (44%)
 Frame = +1

Query: 127 FTQTTSWCWI*KACPKSNQRNPKVR*KTDGNSGHSSRHSLKQILW 261
           F   T W W    CPK N++   V+  T  ++G   +  +K   W
Sbjct: 295 FAIDTDWGWFYFGCPKCNRKTELVKEST--STGKMVKTPMKPKFW 337


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,985,235
Number of Sequences: 28952
Number of extensions: 165782
Number of successful extensions: 361
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 350
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 361
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 782033640
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -