SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30161.Seq
         (888 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearl...   104   9e-23
At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearl...   104   9e-23
At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (AB...    30   1.8  
At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b...    30   1.8  
At5g66815.1 68418.m08424 expressed protein                             29   3.1  
At1g59660.1 68414.m06710 nucleoporin family protein contains Pfa...    29   3.1  
At3g63140.1 68416.m07091 mRNA-binding protein, putative similar ...    29   4.1  
At5g25265.1 68418.m02995 expressed protein                             29   5.4  
At3g08670.1 68416.m01007 expressed protein                             29   5.4  
At5g58410.1 68418.m07314 expressed protein contains similarity t...    28   7.2  
At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putat...    28   7.2  
At3g46400.1 68416.m05030 leucine-rich repeat protein kinase, put...    28   7.2  
At1g27960.1 68414.m03425 expressed protein contains Pfam profile...    28   7.2  
At4g16140.1 68417.m02445 proline-rich family protein contains pr...    28   9.5  
At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family...    28   9.5  
At3g05370.1 68416.m00586 disease resistance family protein conta...    28   9.5  
At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ...    28   9.5  
At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ...    28   9.5  
At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family...    28   9.5  

>At1g18640.2 68414.m02324 3-phosphoserine phosphatase (PSP) nearly
           identical to 3-phosphoserine phosphatase GI:3759177 from
           [Arabidopsis thaliana]
          Length = 295

 Score =  104 bits (249), Expect = 9e-23
 Identities = 49/106 (46%), Positives = 72/106 (67%)
 Frame = +1

Query: 187 AVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           +V+  E +  G +   V   +  +L+R+ + VCFDVDSTV  DEGIDELA+FCG G  V 
Sbjct: 55  SVQPHELSTLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCVDEGIDELAEFCGAGKAVA 114

Query: 367 RLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
             TA AMGG++ F+EAL  RL + +P++ ++ E+++K P RL+PGI
Sbjct: 115 EWTARAMGGSVPFEEALAARLSLFKPSLSKVEEYLDKRPPRLSPGI 160



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 47/94 (50%), Positives = 61/94 (64%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LVK+L    + VYL+SGGFR +I PVA  L IP  NIFAN L F  +GE+ GFDENEPTS
Sbjct: 163 LVKKLRANNIDVYLISGGFRQMINPVASILGIPRENIFANNLLFGNSGEFLGFDENEPTS 222

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           RSGG    V+++ +   Y+ + ++ G G    EA
Sbjct: 223 RSGGKAKAVQQIRKGRLYKTMAMI-GDGATDLEA 255


>At1g18640.1 68414.m02323 3-phosphoserine phosphatase (PSP) nearly
           identical to 3-phosphoserine phosphatase GI:3759177 from
           [Arabidopsis thaliana]
          Length = 295

 Score =  104 bits (249), Expect = 9e-23
 Identities = 49/106 (46%), Positives = 72/106 (67%)
 Frame = +1

Query: 187 AVRDVEDALTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVK 366
           +V+  E +  G +   V   +  +L+R+ + VCFDVDSTV  DEGIDELA+FCG G  V 
Sbjct: 55  SVQPHELSTLGHEGNIVPSKEILDLWRSVEAVCFDVDSTVCVDEGIDELAEFCGAGKAVA 114

Query: 367 RLTAEAMGGNMTFQEALKKRLDIIRPNVGQIREFIEKFPVRLTPGI 504
             TA AMGG++ F+EAL  RL + +P++ ++ E+++K P RL+PGI
Sbjct: 115 EWTARAMGGSVPFEEALAARLSLFKPSLSKVEEYLDKRPPRLSPGI 160



 Score = 90.2 bits (214), Expect = 2e-18
 Identities = 47/94 (50%), Positives = 61/94 (64%)
 Frame = +3

Query: 510 LVKELHERGVIVYLVSGGFRSLIEPVAERLNIPTINIFANRLKFYFNGEYAGFDENEPTS 689
           LVK+L    + VYL+SGGFR +I PVA  L IP  NIFAN L F  +GE+ GFDENEPTS
Sbjct: 163 LVKKLRANNIDVYLISGGFRQMINPVASILGIPRENIFANNLLFGNSGEFLGFDENEPTS 222

Query: 690 RSGGXXLVVRRLXELHGYQRLVIVRGPGLPMPEA 791
           RSGG    V+++ +   Y+ + ++ G G    EA
Sbjct: 223 RSGGKAKAVQQIRKGRLYKTMAMI-GDGATDLEA 255


>At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (ABI3)
           identical to abscisic acid-insensitive protein 3
           GI:16146 SP:Q01593 from [Arabidopsis thaliana], (Plant
           Cell 4 (10), 1251-1261 (1992))
          Length = 720

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 17/47 (36%), Positives = 23/47 (48%)
 Frame = -2

Query: 389 PIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSAVLNNSGQ 249
           P  S+ S  ++SP P N   SS  SS     STS     A+L + G+
Sbjct: 80  PCMSSSSSSSTSPAPVNAIVSSASSSSAASSSTSSAASWAILRSDGE 126


>At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ
           boundaries domain protein 13 (LBD13) identical to LOB
           DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61
          Length = 268

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 16/41 (39%), Positives = 19/41 (46%)
 Frame = -2

Query: 392 PPIASAVSLLTSSPFPQNLASSSMPSSCMTVESTSKQTQSA 270
           PP      LL+S P P      S+PS  M V S+S    SA
Sbjct: 199 PPTPRPPRLLSSQPAPPPTPPVSLPSPSMVVSSSSSSNSSA 239


>At5g66815.1 68418.m08424 expressed protein
          Length = 105

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 14/30 (46%), Positives = 14/30 (46%), Gaps = 1/30 (3%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPV-PGRSPGAG 742
           PP P  PS  G K      P  PG SPG G
Sbjct: 70  PPPPPPPSQSGGKDAEDFRPTTPGHSPGIG 99


>At1g59660.1 68414.m06710 nucleoporin family protein contains Pfam
           profiles: PF04096 nucleoporin autopeptidase, PF03093
           nucleoporin FG repeat family
          Length = 997

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 2/65 (3%)
 Frame = -2

Query: 359 SSPFPQNLASSSMPSSCMTVESTSKQ--TQSAVLNNSGQSVGATSR*STPVRASSTSRTA 186
           S P   +    + PS   TV +T+    + S++  N+ Q +G++   STP   S+   + 
Sbjct: 444 SQPTTPSFGQPTTPSFRSTVSNTTSVFGSSSSLTTNTSQPLGSSIFGSTPAHGSTPGFSI 503

Query: 185 GCFSN 171
           G F+N
Sbjct: 504 GGFNN 508


>At3g63140.1 68416.m07091 mRNA-binding protein, putative similar to
           mRNA binding protein precursor (GI:26453355)
           [Lycopersicon esculentum]
          Length = 406

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 7/74 (9%)
 Frame = -2

Query: 440 LMMSSLFFKASW-----NVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVES--TSKQ 282
           L  SSLFF +       N+++PP     SL +SS    +L+SSS  SS +   S  TS++
Sbjct: 4   LSSSSLFFSSKTTSPISNLLIPPSLHRFSLPSSSSSFSSLSSSSSSSSSLLTFSLRTSRR 63

Query: 281 TQSAVLNNSGQSVG 240
                      SVG
Sbjct: 64  LSPQKFTVKASSVG 77


>At5g25265.1 68418.m02995 expressed protein
          Length = 366

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 15/44 (34%), Positives = 25/44 (56%)
 Frame = -1

Query: 231 TLIDTSESVFNVAYCRLLFKL*RAISVASSPSNETIMIEFTSIL 100
           T +  S+SV+N   CR+++   + I  ++ P +E  M  FT IL
Sbjct: 72  TAVTASDSVYNTWQCRVMYYWFKKIQASAGPGSE--MGGFTRIL 113


>At3g08670.1 68416.m01007 expressed protein 
          Length = 567

 Score = 28.7 bits (61), Expect = 5.4
 Identities = 31/102 (30%), Positives = 45/102 (44%)
 Frame = -2

Query: 500 PGVSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASSSM 321
           PG  L GN S +SL  P +    S+    AS    L    S     +S P   +  +   
Sbjct: 105 PGTPL-GNDSHSSLAAPKIA--SSARASSASKASRLSVSQSESGYHSSRPARSSSVTRPS 161

Query: 320 PSSCMTVESTSKQTQSAVLNNSGQSVGATSR*STPVRASSTS 195
            S+      TS ++ S++LN S  SV +  R S+P   SS+S
Sbjct: 162 ISTSQYSSFTSGRSPSSILNTSSASVSSYIRPSSPSSRSSSS 203


>At5g58410.1 68418.m07314 expressed protein contains similarity to
           hypothetical proteins
          Length = 1873

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 119 IIIVSLLGEEATEMALYSLKSNLQYATLKTLSLVSISVMSPQQTVRS 259
           +I+V+    E  + + +SLKS  Q ATL T  L SI ++  +  + S
Sbjct: 831 VIVVAKFAAEVIDGSFFSLKSLSQDATLLTTVLSSIFIIDLENRMTS 877


>At4g33520.3 68417.m04762 metal-transporting P-type ATPase, putative
            (PAA1) nearly identical to gi:2668492; contains Pfam
            heavy-metal-associated domain PF00403
          Length = 949

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 22/81 (27%), Positives = 36/81 (44%)
 Frame = -2

Query: 506  VIPGVSLTGNFSMNSLI*PTLGLMMSSLFFKASWNVILPPIASAVSLLTSSPFPQNLASS 327
            V+ G  LT       L   T+  +  +L++   +N++  PIA+ V L    P    + + 
Sbjct: 839  VLMGNRLTQLLDAMELSRQTMKTVKQNLWWAFGYNIVRIPIAAGVLL----PLTGTMLTP 894

Query: 326  SMPSSCMTVESTSKQTQSAVL 264
            SM  + M V S    T S +L
Sbjct: 895  SMAGALMGVSSLGVMTNSLLL 915


>At3g46400.1 68416.m05030 leucine-rich repeat protein kinase,
           putative similar to light repressible receptor protein
           kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376;
           contains leucine rich repeat (LRR) domains,
           Pfam:PF00560; contains protein kinase domain,
           Pfam:PF00069
          Length = 883

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = -2

Query: 425 LFFKASWNVILPPIASAVSLLTSSPFPQNLASSSMPSSCMTVEST 291
           L  K + N  LPP+ +A+ + T   FPQ+  +    S+   ++ T
Sbjct: 333 LELKRTQNSTLPPLLTAIEVFTVIDFPQSKTNEDDVSAIKNIKDT 377


>At1g27960.1 68414.m03425 expressed protein contains Pfam profile
           PF04146: YT521-B-like family
          Length = 539

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +1

Query: 253 PELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMGGN 396
           P    T      + D +V+QD+ I     FCG+G E   + A+    N
Sbjct: 12  PPTTTTGSFTGLNTDQSVLQDQDIVSSRPFCGQGTESFHIGADTPRSN 59


>At4g16140.1 68417.m02445 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 164

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 12/33 (36%), Positives = 13/33 (39%)
 Frame = -1

Query: 840 NQGXPPKPMKPSAGGXKPRASVAPVPGRSPGAG 742
           N   PP P  PS     P  +  P P  S G G
Sbjct: 44  NPSPPPPPSNPSPPPPSPTTTACPPPPSSSGGG 76


>At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family
           protein Common family members: At4g18570, At4g04980,
           At5g61090 [Arabidopsis thaliana];  identical to cDNA
           CHUP1 for actin binding protein GI:28071264
          Length = 1004

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 18/57 (31%), Positives = 21/57 (36%)
 Frame = -1

Query: 834 GXPPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQISMLARFHRS 664
           G PP P  P  G   P     P P   PGA  R         N  H+   L  F++S
Sbjct: 678 GPPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGG----NKVHRAPELVEFYQS 730


>At3g05370.1 68416.m00586 disease resistance family protein contains
           leucine rich-repeat domains Pfam:PF00560,
           INTERPRO:IPR001611; similar to Cf-2 disease resistance
           protein GB:AAC15780 from [Lycopersicon pimpinellifolium]
          Length = 860

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 19/73 (26%), Positives = 33/73 (45%)
 Frame = +1

Query: 211 LTGVDQRDVAPTDCPELFRTADCVCFDVDSTVIQDEGIDELAKFCGKGDEVKRLTAEAMG 390
           LTG D  D   ++ P + +  +   F VDS  I ++G++   K   + ++V   +     
Sbjct: 622 LTGEDG-DFRLSEAPYMGKVLNATAFFVDSMEIVNKGVETEFKRINEENKVINFSGNRFS 680

Query: 391 GNMTFQEALKKRL 429
           GN+     L K L
Sbjct: 681 GNIPESIGLLKEL 693


>At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing
           protein similar to RNA recognition motif-containing
           protein SEB-4 GI:8895698 from [Xenopus laevis]; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 271

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +2

Query: 527 RKRSHRISSFGRIQESNRTGRGETKHPN-YQ 616
           RK +  I+SFGR + S   GRG+T  P+ YQ
Sbjct: 85  RKANCNIASFGRPRPSPPRGRGQTGSPSQYQ 115


>At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing
           protein similar to RNA recognition motif-containing
           protein SEB-4 GI:8895698 from [Xenopus laevis]; contains
           InterPro entry IPR000504: RNA-binding region RNP-1 (RNA
           recognition motif) (RRM)
          Length = 287

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +2

Query: 527 RKRSHRISSFGRIQESNRTGRGETKHPN-YQ 616
           RK +  I+SFGR + S   GRG+T  P+ YQ
Sbjct: 85  RKANCNIASFGRPRPSPPRGRGQTGSPSQYQ 115


>At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family
           protein contains proline-rich extensin domains,
           INTERPRO:IPR002965
          Length = 554

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 18/52 (34%), Positives = 20/52 (38%)
 Frame = -1

Query: 828 PPKPMKPSAGGXKPRASVAPVPGRSPGAGTRAIXSVVSPLNXXHQISMLARF 673
           PP P  P A G    A   P PG   G G +    V S L     +  L RF
Sbjct: 260 PPPPPLPMAAGKGVAAPPPPPPGARGGLGAK---KVTSKLKRSTHLGALFRF 308


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,932,771
Number of Sequences: 28952
Number of extensions: 369665
Number of successful extensions: 1188
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 1112
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1187
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2081245872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -