SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30160.Seq
         (904 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g16340.1 68416.m02066 ABC transporter family protein similar ...    29   5.6  
At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing ...    28   7.4  
At4g23760.1 68417.m03418 expressed protein                             28   7.4  
At2g27390.1 68415.m03306 proline-rich family protein contains pr...    28   7.4  
At2g38410.1 68415.m04718 VHS domain-containing protein / GAT dom...    28   9.7  
At1g07970.1 68414.m00868 expressed protein                             28   9.7  

>At3g16340.1 68416.m02066 ABC transporter family protein similar to
            PDR5-like ABC transporter GI:1514643 from [Spirodela
            polyrhiza]; contains Pfam profile: PF00005 ABC
            transporter
          Length = 1416

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 17/69 (24%), Positives = 33/69 (47%), Gaps = 1/69 (1%)
 Frame = +1

Query: 133  MY-VIPFSMGPVGSPLSKIGVEITDSPYVVYSMRVMTRIGAKF*KFYVKTSSSFVVFTQS 309
            MY  +P+++  V   +  + ++ T    ++Y+M       AKF  FY  +  SF+ FT  
Sbjct: 1231 MYSALPYALAQVVCEIPYVLIQTTYYTLIIYAMMCFEWTLAKFFWFYFVSFMSFLYFTYY 1290

Query: 310  APVALRVGP 336
              + + + P
Sbjct: 1291 GMMTVALTP 1299


>At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing
           protein KIAA0332 gene, Homo sapiens, EMBL:HSAB2330
          Length = 947

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 12/29 (41%), Positives = 15/29 (51%)
 Frame = -1

Query: 364 WSMMVFLGSQGQPGVPPEPTA*RQRTNCS 278
           W  +VFL SQ  P  PP   A R +  C+
Sbjct: 265 WGKVVFLPSQALPAPPPGHMAIRSKEGCN 293


>At4g23760.1 68417.m03418 expressed protein 
          Length = 187

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 12/33 (36%), Positives = 18/33 (54%)
 Frame = -3

Query: 209 GESVISTPIFERGDPTGPIENGITYIVRPSHPI 111
           GE+  ST +  RG PT  +  G+++  R   PI
Sbjct: 130 GETEYSTNLRPRGSPTSQLRRGVSFRSREMRPI 162


>At2g27390.1 68415.m03306 proline-rich family protein contains
           proline-rich extensin domains, INTERPRO:IPR002965
          Length = 134

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 15/45 (33%), Positives = 18/45 (40%)
 Frame = -1

Query: 895 FDLFPXXTXPFXELGPNAFPTKPPNXSXVFPPRLVNTXVFEXPVP 761
           F L P    P     P++ P  PP    +FPP       FE P P
Sbjct: 34  FPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPP 78


>At2g38410.1 68415.m04718 VHS domain-containing protein / GAT
           domain-containing protein weak similarity to hepatocyte
           growth factor-regulated tyrosine kinase substrate HRS
           isoform 2 [Homo sapiens] GI:9022389; contains Pfam
           profiles PF00790: VHS domain, PF03127: GAT domain
          Length = 671

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%)
 Frame = -1

Query: 652 LHQ-GYVVPHAXYFVPGPVFGVIMARFVFPQ 563
           +HQ GY VP A Y +P   +GV  A +  PQ
Sbjct: 179 VHQAGYGVPQAGYGIPQAGYGVPQAGYGIPQ 209


>At1g07970.1 68414.m00868 expressed protein
          Length = 693

 Score = 27.9 bits (59), Expect = 9.7
 Identities = 18/48 (37%), Positives = 22/48 (45%)
 Frame = -2

Query: 738 PXDXTWXQLPKNPFFRXKWPRKYAVLXRNFIKAMSSPTXSTLYPGQCL 595
           P   T  Q  KNP F    P K       +I A+ S   STL+PG C+
Sbjct: 578 PSSYTGTQASKNPLFLGVLPPKER-FPEKYI-AVVSGVPSTLHPGACV 623


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,561,970
Number of Sequences: 28952
Number of extensions: 374160
Number of successful extensions: 888
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 853
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 883
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2129873112
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -