SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30158.Seq
         (813 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g18770.1 68415.m02185 expressed protein                             42   5e-04
At5g05670.2 68418.m00624 expressed protein                             41   9e-04
At5g05670.1 68418.m00623 expressed protein                             41   9e-04
At5g47110.1 68418.m05808 lil3 protein, putative similar to Lil3 ...    31   0.91 
At2g45700.1 68415.m05682 sterile alpha motif (SAM) domain-contai...    30   1.6  
At2g29090.1 68415.m03536 cytochrome P450 family protein similar ...    29   2.8  
At5g57580.1 68418.m07194 calmodulin-binding protein similar to c...    29   3.7  
At1g31150.1 68414.m03811 expressed protein EST gb|Z33866 comes f...    28   6.4  

>At2g18770.1 68415.m02185 expressed protein
          Length = 260

 Score = 41.9 bits (94), Expect = 5e-04
 Identities = 25/91 (27%), Positives = 42/91 (46%)
 Frame = +3

Query: 348 KTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXG 527
           K + ++D+PG  RL +K   ++   A  +VFV+ ++     I   + YLY IL   S   
Sbjct: 109 KPVHLIDVPGHSRLISKL-EEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNASVIK 167

Query: 528 TQLPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            + P   C NK  +      +  +   EKE+
Sbjct: 168 NKTPVLLCCNKTDKVTAHTKEFIRKQMEKEI 198


>At5g05670.2 68418.m00624 expressed protein 
          Length = 260

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 26/91 (28%), Positives = 41/91 (45%)
 Frame = +3

Query: 348 KTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXG 527
           K + +VD+PG  RLR K   +    A  IVFV+ ++         + YLY IL   +   
Sbjct: 109 KPVHLVDVPGHSRLRPKL-EEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNANVVK 167

Query: 528 TQLPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            ++P   C NK  +      +  +   EKE+
Sbjct: 168 KKIPVLLCCNKTDKLTAHTKEFIRKQMEKEI 198


>At5g05670.1 68418.m00623 expressed protein 
          Length = 260

 Score = 41.1 bits (92), Expect = 9e-04
 Identities = 26/91 (28%), Positives = 41/91 (45%)
 Frame = +3

Query: 348 KTLKIVDLPGXERLRNKFFXQHXSSAKGIVFVIXSINIXEEIXDVAXYLYTILWIRSFXG 527
           K + +VD+PG  RLR K   +    A  IVFV+ ++         + YLY IL   +   
Sbjct: 109 KPVHLVDVPGHSRLRPKL-EEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNANVVK 167

Query: 528 TQLPX*YCGNKQXQP*PKXAQLSKGYSEKEL 620
            ++P   C NK  +      +  +   EKE+
Sbjct: 168 KKIPVLLCCNKTDKLTAHTKEFIRKQMEKEI 198


>At5g47110.1 68418.m05808 lil3 protein, putative similar to Lil3
           protein [Arabidopsis thaliana] gi|4741966|gb|AAD28780
          Length = 258

 Score = 31.1 bits (67), Expect = 0.91
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
 Frame = +1

Query: 46  DLVSVKRKNST-MESEVVKEKIHTEPILNDPRYITLLSLIVLAVTLIFWWIFSRRYTLRN 222
           DL   ++   T  +S +V E    + + ++P   +   L+V   ++I WW + +RY L  
Sbjct: 110 DLKQFEKDGKTDWDSVIVSEAKRRKWLEDNPETTSNDELVVFDTSIIPWWAWMKRYHLPE 169

Query: 223 SVLLMG 240
           + LL G
Sbjct: 170 AELLNG 175


>At2g45700.1 68415.m05682 sterile alpha motif (SAM)
           domain-containing protein similar to SNM1 protein [Mus
           musculus] GI:7595835; contains Pfam profile PF00536: SAM
           domain (Sterile alpha motif)
          Length = 723

 Score = 30.3 bits (65), Expect = 1.6
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +3

Query: 159 YCSSSNPHILVDFLSKVYSSQLSIVNGPI 245
           +CSSS PH ++D +       L   NGPI
Sbjct: 65  FCSSSTPHCILDCIPSSVDCSLGDFNGPI 93


>At2g29090.1 68415.m03536 cytochrome P450 family protein similar to
           Cytochrome P450 88A3 (SP:O23051) [Arabidopsis thaliana];
           similar to taxane 13-alpha-hydroxylase (GI:17148242)
           [Taxus cuspidata].
          Length = 482

 Score = 29.5 bits (63), Expect = 2.8
 Identities = 14/39 (35%), Positives = 21/39 (53%)
 Frame = +1

Query: 127 NDPRYITLLSLIVLAVTLIFWWIFSRRYTLRNSVLLMGL 243
           ++P  ITL  ++V+ V L  WW+  +   LR     MGL
Sbjct: 18  DEPALITLTIVVVVVVLLFKWWLHWKEQRLRLPPGSMGL 56


>At5g57580.1 68418.m07194 calmodulin-binding protein similar to
           calmodulin-binding protein TCB60 GI:1698548 from
           [Nicotiana tabacum]
          Length = 647

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
 Frame = +1

Query: 82  ESEVVKEKIHTEPILNDPRYITLLSLIVLAVTLIFW----WIFSRRYTL 216
           ES VVKE+    P+L    Y+TL   +     L+F     WI SR++ L
Sbjct: 166 ESHVVKERSGKRPLLTGEVYVTLKEGVGTLGELVFTDNSSWIRSRKFRL 214


>At1g31150.1 68414.m03811 expressed protein EST gb|Z33866 comes from
           this gene
          Length = 673

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +1

Query: 88  EVVKEKIHTEPILNDPRYITLLSLIVLAVTLIFWWIFSRRYTLRNSV 228
           E +K K+H     NDP Y+TL  L  +       WI  +   LRN +
Sbjct: 404 EKIKAKVHVGGESNDPGYVTLAYLNDMKE-----WILKQNQDLRNKI 445


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,643,421
Number of Sequences: 28952
Number of extensions: 256938
Number of successful extensions: 569
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 550
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 567
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1853336000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -