SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30156.Seq
         (961 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C)             159   3e-39
At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ri...   159   3e-39
At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) simila...   157   1e-38
At1g58983.1 68414.m06666 40S ribosomal protein S2, putative simi...   157   1e-38
At1g58684.1 68414.m06657 40S ribosomal protein S2, putative           157   1e-38
At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) simila...   157   1e-38
At2g33800.1 68415.m04147 ribosomal protein S5 family protein con...    48   1e-05
At5g35970.1 68418.m04332 DNA-binding protein, putative similar t...    30   2.6  
At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim...    29   4.6  
At1g06470.2 68414.m00686 phosphate translocator-related low simi...    29   4.6  
At1g06470.1 68414.m00685 phosphate translocator-related low simi...    29   4.6  
At5g59520.1 68418.m07459 zinc transporter (ZIP2) identical to zi...    28   8.0  
At3g18530.1 68416.m02357 expressed protein similar to unknown pr...    28   8.0  

>At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C)
          Length = 285

 Score =  159 bits (386), Expect = 3e-39
 Identities = 75/106 (70%), Positives = 87/106 (82%)
 Frame = +1

Query: 226 RQTREHLLVFLPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNG 405
           +Q  +  L  LP+KE++IID  +GP+L DEV+KIMPVQKQTRAGQRTRFKAFV +GD NG
Sbjct: 70  KQIEQIYLHSLPVKEYQIIDMLIGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNG 129

Query: 406 HIGLGVKCSKEVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           H+GLGVKCSKEVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 130 HVGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 175



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 39/148 (26%), Positives = 65/148 (43%), Gaps = 3/148 (2%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSR---SLISSSARP*MMRFLRSCLY 337
           ++++WVPVTKLGRLV  G I ++E IYL     K  +    LI  + +  +M+ +   + 
Sbjct: 50  EEEKWVPVTKLGRLVAAGHIKQIEQIYLHSLPVKEYQIIDMLIGPTLKDEVMKIMP--VQ 107

Query: 338 RNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVT 517
           +             ++       + + V   +++        + L      PVRR Y   
Sbjct: 108 KQTRAGQRTRFKAFVVVGDGNGHVGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYWGN 166

Query: 518 R*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           +     TVPCKV G+       R++PAP
Sbjct: 167 KIGKPHTVPCKVTGKCG-SVTVRMVPAP 193


>At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S
           ribosomal protein S2 - Arabidopsis thaliana,
           SWISSPROT:RS2_ARATH
          Length = 276

 Score =  159 bits (385), Expect = 3e-39
 Identities = 73/96 (76%), Positives = 84/96 (87%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE++IID  +GPSL DEV+KIMPVQKQTRAGQRTRFKAF+ +GD+NGH+GLGVKCSK
Sbjct: 71  LPVKEYQIIDLLVGPSLKDEVMKIMPVQKQTRAGQRTRFKAFIVVGDSNGHVGLGVKCSK 130

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           EVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 131 EVATAIRGAIILAKLSVVPIRRGYWGNKIGKPHTVP 166



 Score = 56.0 bits (129), Expect = 3e-08
 Identities = 41/148 (27%), Positives = 69/148 (46%), Gaps = 3/148 (2%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSR---SLISSSARP*MMRFLRSCLY 337
           ++++WVPVTKLGRLV+EGKI K+E IYL     K  +    L+  S +  +M+ +   + 
Sbjct: 41  EEEKWVPVTKLGRLVKEGKITKIEQIYLHSLPVKEYQIIDLLVGPSLKDEVMKIMP--VQ 98

Query: 338 RNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVT 517
           +             ++   +   + + V   +++        + L      P+RR Y   
Sbjct: 99  KQTRAGQRTRFKAFIVVGDSNGHVGLGV-KCSKEVATAIRGAIILAKLSVVPIRRGYWGN 157

Query: 518 R*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           +     TVPCKV G+       R++PAP
Sbjct: 158 KIGKPHTVPCKVTGKCG-SVTVRMVPAP 184


>At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) similar
           to ribosomal protein S2 GI:430711 from [Drosophila
           melanogaster]
          Length = 284

 Score =  157 bits (381), Expect = 1e-38
 Identities = 73/96 (76%), Positives = 83/96 (86%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE++IID  +GP+L DEV+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSK
Sbjct: 79  LPVKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSK 138

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           EVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 139 EVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 174



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 40/148 (27%), Positives = 65/148 (43%), Gaps = 3/148 (2%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSR---SLISSSARP*MMRFLRSCLY 337
           ++ +WVPVTKLGRLV + KI KLE IYL     K  +    L+  + +  +M+ +   + 
Sbjct: 49  EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMP--VQ 106

Query: 338 RNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVT 517
           +             ++       + + V   +++        + L      PVRR Y   
Sbjct: 107 KQTRAGQRTRFKAFVVVGDGNGHVGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYWGN 165

Query: 518 R*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           +     TVPCKV G+       R++PAP
Sbjct: 166 KIGKPHTVPCKVTGKCG-SVTVRMVPAP 192


>At1g58983.1 68414.m06666 40S ribosomal protein S2, putative similar
           to ribosomal protein S2 GI:939717 from [Urechis caupo]
          Length = 284

 Score =  157 bits (381), Expect = 1e-38
 Identities = 73/96 (76%), Positives = 83/96 (86%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE++IID  +GP+L DEV+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSK
Sbjct: 79  LPVKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSK 138

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           EVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 139 EVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 174



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 40/148 (27%), Positives = 65/148 (43%), Gaps = 3/148 (2%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSR---SLISSSARP*MMRFLRSCLY 337
           ++ +WVPVTKLGRLV + KI KLE IYL     K  +    L+  + +  +M+ +   + 
Sbjct: 49  EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMP--VQ 106

Query: 338 RNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVT 517
           +             ++       + + V   +++        + L      PVRR Y   
Sbjct: 107 KQTRAGQRTRFKAFVVVGDGNGHVGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYWGN 165

Query: 518 R*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           +     TVPCKV G+       R++PAP
Sbjct: 166 KIGKPHTVPCKVTGKCG-SVTVRMVPAP 192


>At1g58684.1 68414.m06657 40S ribosomal protein S2, putative 
          Length = 284

 Score =  157 bits (381), Expect = 1e-38
 Identities = 73/96 (76%), Positives = 83/96 (86%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE++IID  +GP+L DEV+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSK
Sbjct: 79  LPVKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSK 138

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           EVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 139 EVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 174



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 40/148 (27%), Positives = 65/148 (43%), Gaps = 3/148 (2%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSR---SLISSSARP*MMRFLRSCLY 337
           ++ +WVPVTKLGRLV + KI KLE IYL     K  +    L+  + +  +M+ +   + 
Sbjct: 49  EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMP--VQ 106

Query: 338 RNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVT 517
           +             ++       + + V   +++        + L      PVRR Y   
Sbjct: 107 KQTRAGQRTRFKAFVVVGDGNGHVGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYWGN 165

Query: 518 R*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           +     TVPCKV G+       R++PAP
Sbjct: 166 KIGKPHTVPCKVTGKCG-SVTVRMVPAP 192


>At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) similar
           to ribosomal protein S2 GI:939717 from (Urechis caupo)
          Length = 284

 Score =  157 bits (381), Expect = 1e-38
 Identities = 73/96 (76%), Positives = 83/96 (86%)
 Frame = +1

Query: 256 LPIKEFEIIDFFLGPSLNDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSK 435
           LP+KE++IID  +GP+L DEV+KIMPVQKQTRAGQRTRFKAFV +GD NGH+GLGVKCSK
Sbjct: 79  LPVKEYQIIDHLVGPTLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDGNGHVGLGVKCSK 138

Query: 436 EVATAIRGAIILAKLSVLTSPKKLRGNKIGKPHNRP 543
           EVATAIRGAIILAKLSV+   +   GNKIGKPH  P
Sbjct: 139 EVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVP 174



 Score = 49.2 bits (112), Expect = 4e-06
 Identities = 40/148 (27%), Positives = 65/148 (43%), Gaps = 3/148 (2%)
 Frame = +2

Query: 167 DQKEWVPVTKLGRLVREGKIDKLESIYLFFYQSKNSR---SLISSSARP*MMRFLRSCLY 337
           ++ +WVPVTKLGRLV + KI KLE IYL     K  +    L+  + +  +M+ +   + 
Sbjct: 49  EETKWVPVTKLGRLVADNKITKLEQIYLHSLPVKEYQIIDHLVGPTLKDEVMKIMP--VQ 106

Query: 338 RNKHVPDSAHVSRHLLPLATTTVILVWV*SAARKSPLPFEALLSLLSCQF*PVRRSYGVT 517
           +             ++       + + V   +++        + L      PVRR Y   
Sbjct: 107 KQTRAGQRTRFKAFVVVGDGNGHVGLGV-KCSKEVATAIRGAIILAKLSVVPVRRGYWGN 165

Query: 518 R*ESHTTVPCKVXGQXWFPKQFRLIPAP 601
           +     TVPCKV G+       R++PAP
Sbjct: 166 KIGKPHTVPCKVTGKCG-SVTVRMVPAP 192


>At2g33800.1 68415.m04147 ribosomal protein S5 family protein
           contains Pfam profiles PF03719: Ribosomal protein S5,
           C-terminal domain, PF00333: Ribosomal protein S5,
           N-terminal domain
          Length = 303

 Score = 47.6 bits (108), Expect = 1e-05
 Identities = 19/63 (30%), Positives = 40/63 (63%)
 Frame = +1

Query: 310 DEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVL 489
           + V+++  V K  + G++ +F+A V +GD  G++G+G   +KEV  A++ + I A+ +++
Sbjct: 149 ERVVQVRRVTKVVKGGKQLKFRAIVVVGDKQGNVGVGCAKAKEVVAAVQKSAIDARRNIV 208

Query: 490 TSP 498
             P
Sbjct: 209 QVP 211


>At5g35970.1 68418.m04332 DNA-binding protein, putative similar to
           SWISS-PROT:Q60560 DNA-binding protein SMUBP-2
           (Immunoglobulin MU binding protein 2, SMUBP-2)
           [Mesocricetus auratus]
          Length = 961

 Score = 29.9 bits (64), Expect = 2.6
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = -3

Query: 356 PARVCFCTGMILRTSSFRDGPRKKSMISNSLIGKKTSK 243
           P R  FC+G+   +S  +  PR+KS +S+ L  KK  K
Sbjct: 43  PTRKVFCSGVNGGSSVTKKKPRRKSNVSDKLRFKKIEK 80


>At1g80480.1 68414.m09427 PRLI-interacting factor L, putative
           similar to PRLI-interacting factor L [Arabidopsis
           thaliana] GI:11139268; contains Pfam profile PF02492:
           Cobalamin synthesis protein/P47K
          Length = 444

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 10/20 (50%), Positives = 11/20 (55%)
 Frame = -3

Query: 152 HDHGRDHDRVHEDRHGLYLH 93
           HDH  DHD  H D H  + H
Sbjct: 320 HDHNHDHDHHHHDGHDHHHH 339


>At1g06470.2 68414.m00686 phosphate translocator-related low
           similarity to SP|P52178 Triose phosphate/phosphate
           translocator, non-green plastid, chloroplast precursor
           (CTPT) {Brassica oleracea},
           phosphoenolpyruvate/phosphate translocator precursor
           [Mesembryanthemum crystallinum] GI:9295275
          Length = 414

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 16/43 (37%), Positives = 20/43 (46%)
 Frame = -3

Query: 539 RLCGFPILLPRNFFGLVRTDSLARIIAPRMAVATSLLHFTPKP 411
           R C   +LL +  FGL         +AP MA+AT LL     P
Sbjct: 240 RWCMTQVLLQKETFGLKNPFIFMSCVAPVMAIATGLLSLLLDP 282


>At1g06470.1 68414.m00685 phosphate translocator-related low
           similarity to SP|P52178 Triose phosphate/phosphate
           translocator, non-green plastid, chloroplast precursor
           (CTPT) {Brassica oleracea},
           phosphoenolpyruvate/phosphate translocator precursor
           [Mesembryanthemum crystallinum] GI:9295275
          Length = 414

 Score = 29.1 bits (62), Expect = 4.6
 Identities = 16/43 (37%), Positives = 20/43 (46%)
 Frame = -3

Query: 539 RLCGFPILLPRNFFGLVRTDSLARIIAPRMAVATSLLHFTPKP 411
           R C   +LL +  FGL         +AP MA+AT LL     P
Sbjct: 240 RWCMTQVLLQKETFGLKNPFIFMSCVAPVMAIATGLLSLLLDP 282


>At5g59520.1 68418.m07459 zinc transporter (ZIP2) identical to zinc
           transporter ZIP2 [Arabidopsis thaliana]
           gi|3252868|gb|AAC24198; member of the Zinc (Zn2+)-Iron
           (Fe2+) permease (ZIP) family, PMID:11500563
          Length = 353

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 12/21 (57%), Positives = 14/21 (66%)
 Frame = +1

Query: 376 AFVAIGDNNGHIGLGVKCSKE 438
           AFVA G NN H+G  V  S+E
Sbjct: 149 AFVAAGSNNNHVGASVGESRE 169


>At3g18530.1 68416.m02357 expressed protein similar to unknown
           protein GB:AAF24615 from [Arabidopsis thaliana]
          Length = 297

 Score = 28.3 bits (60), Expect = 8.0
 Identities = 16/53 (30%), Positives = 23/53 (43%)
 Frame = -3

Query: 461 APRMAVATSLLHFTPKPI*PLLSPMATNALKRVRCPARVCFCTGMILRTSSFR 303
           A   A+     H +P  + P L P   N   R+R  A  CF +G + R  + R
Sbjct: 184 AAERALVAMTTHVSPALLLPKLRPCLKNKSPRIRAKASACF-SGCVPRLEAAR 235


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,112,523
Number of Sequences: 28952
Number of extensions: 361895
Number of successful extensions: 893
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 841
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 889
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2314656624
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -