SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30155.Seq
         (883 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g57380.1 68418.m07169 fibronectin type III domain-containing ...    30   2.4  
At1g19230.1 68414.m02393 respiratory burst oxidase protein E (Rb...    29   3.1  
At5g45640.1 68418.m05612 subtilase family protein contains Pfam ...    29   4.1  
At1g09000.1 68414.m01004 NPK1-related protein kinase, putative (...    28   7.2  
At1g06090.1 68414.m00638 fatty acid desaturase family protein si...    28   7.2  
At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger) fa...    28   9.5  

>At5g57380.1 68418.m07169 fibronectin type III domain-containing
           protein / PHD finger protein-related contains Pfam
           profiles PF00041: Fibronectin type III domain, PF00628:
           PHD-finger
          Length = 600

 Score = 29.9 bits (64), Expect = 2.4
 Identities = 14/34 (41%), Positives = 23/34 (67%)
 Frame = +1

Query: 265 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGR 366
           D+D  E CS+ E ES ++E  L +++A N++ GR
Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGR 466


>At1g19230.1 68414.m02393 respiratory burst oxidase protein E
           (RbohE) / NADPH oxidase nearly identical to respiratory
           burst oxidase protein E GI:3242787 [gi:3242787] from
           [Arabidopsis thaliana]
          Length = 926

 Score = 29.5 bits (63), Expect = 3.1
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +3

Query: 321 TWTPTSK--GEKPSIRAMAHYVNHHPNQVFWGRGAVK 425
           T TPTS   G+K +++A  ++V   P  V W RG ++
Sbjct: 777 TATPTSTHGGKKKAVKAHFYWVTREPGSVEWFRGVME 813


>At5g45640.1 68418.m05612 subtilase family protein contains Pfam
           domain, PF00082: Subtilase family; contains Pfam domain,
           PF02225: protease associated (PA) domain
          Length = 754

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 1/59 (1%)
 Frame = +1

Query: 676 MYXAHETITLIN-ASIILKKEEYEYSTFPWRLIPFLRHFXFPVFAHPENVVKVKDAEDS 849
           +Y  +E +  I  A  +L + + E S +P++  PF+  F   + A   N++      DS
Sbjct: 462 IYNTYEPVAFIKPAETVLYRNQPEDSVYPYKPAPFMTSFLPDIIAPGLNILAAWSGADS 520


>At1g09000.1 68414.m01004 NPK1-related protein kinase, putative
           (ANP1) similar to protein kinase [Nicotiana tabacum]
           gi|456309|dbj|BAA05648; identical to cDNA NPK1-related
           protein kinase 1S GI:2342422
          Length = 666

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +1

Query: 217 LTNRPKSAKSLINKRIDRDRVECCSSLEQESTIKERGLQRQRAKNRLS 360
           L+   K  K  +++ ++R R E        S+ ++RG+ RQR K+R +
Sbjct: 615 LSEIEKKWKEELDQELERKRQEIMRQAGLGSSPRDRGMSRQREKSRFA 662


>At1g06090.1 68414.m00638 fatty acid desaturase family protein
           similar to delta 9 acyl-lipid desaturase GB:BAA25180
           GI:2970034 (ADS1) from [Arabidopsis thaliana]
          Length = 299

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = -1

Query: 334 VGVHVL**WTLVPNWNNTQPYLGLFFCL*GILPISAYWLKN 212
           +G+H+L  WTLV  W    PYL     + G +  +  WL N
Sbjct: 174 IGLHILTFWTLVYLWGGL-PYLTCGVGVGGTIGYNGTWLIN 213


>At3g15070.1 68416.m01906 zinc finger (C3HC4-type RING finger)
           family protein similar to C-terminal zinc-finger
           [Glycine max] GI:558543; contains Pfam profile: PF00097
           zinc finger, C3HC4 type (RING finger)
          Length = 486

 Score = 27.9 bits (59), Expect = 9.5
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +3

Query: 327 TPTSKGEKPSIRAMAHYVNHHP 392
           T +S+   PS+    HY++HHP
Sbjct: 260 TSSSRNPTPSVYQRNHYISHHP 281


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,492,926
Number of Sequences: 28952
Number of extensions: 377655
Number of successful extensions: 814
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 785
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 812
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2077687200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -