SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30153.Seq
         (864 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g18240.2 68416.m02321 expressed protein                             32   0.43 
At3g18240.1 68416.m02320 expressed protein                             32   0.43 
At5g48940.1 68418.m06054 leucine-rich repeat transmembrane prote...    29   4.0  

>At3g18240.2 68416.m02321 expressed protein
          Length = 419

 Score = 32.3 bits (70), Expect = 0.43
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +1

Query: 562 NPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHS 696
           +P  R V + V + +L L KH   + + LVG RY    D +TI S
Sbjct: 307 HPKNRKVKMSVTVKELGLSKHQAKRLRELVGKRYHSGKDELTITS 351


>At3g18240.1 68416.m02320 expressed protein
          Length = 419

 Score = 32.3 bits (70), Expect = 0.43
 Identities = 17/45 (37%), Positives = 24/45 (53%)
 Frame = +1

Query: 562 NPLARVVILRVQLADLKLDKHATDKFKRLVGDRYDPKTDLVTIHS 696
           +P  R V + V + +L L KH   + + LVG RY    D +TI S
Sbjct: 307 HPKNRKVKMSVTVKELGLSKHQAKRLRELVGKRYHSGKDELTITS 351


>At5g48940.1 68418.m06054 leucine-rich repeat transmembrane protein
           kinase, putative 
          Length = 1135

 Score = 29.1 bits (62), Expect = 4.0
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 10/57 (17%)
 Frame = +1

Query: 214 KELMCSQIGSTGWPKPELGECVA----------WSENFPPVFGAITDTSGLRTKGSS 354
           +EL  +  G TG   PELG+CV+           SEN P   G I+    +R  G+S
Sbjct: 157 QELCLNSNGLTGKIPPELGDCVSLKNLEIFDNYLSENLPLELGKISTLESIRAGGNS 213


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,730,098
Number of Sequences: 28952
Number of extensions: 403674
Number of successful extensions: 1083
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 1052
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1082
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2019160800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -