SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30152.Seq
         (877 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g55760.1 68414.m06384 BTB/POZ domain-containing protein Inter...    36   0.027
At5g19330.1 68418.m02303 armadillo/beta-catenin repeat family pr...    31   1.0  
At1g21780.1 68414.m02726 BTB/POZ domain-containing protein Conta...    31   1.0  
At2g40450.1 68415.m04992 speckle-type POZ protein-related contai...    30   1.8  
At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Inter...    29   4.1  
At1g03140.1 68414.m00291 splicing factor Prp18 family protein co...    28   9.4  

>At1g55760.1 68414.m06384 BTB/POZ domain-containing protein Interpro
           IPR000210/ PS50097: BTBB/POZ domain; similar to POZ 56
           protein (GI:17483747) [Mus musculus]
          Length = 329

 Score = 36.3 bits (80), Expect = 0.027
 Identities = 24/82 (29%), Positives = 42/82 (51%)
 Frame = +3

Query: 138 AQRNGKRPK*QSDGGSGNRSVHVGGSDAGAPSTARVSSACDAIVRADDGASFPVHRAILS 317
           +Q +G+     ++G + N+S     +  G   T  + +  D  + A DG S   HRA+L+
Sbjct: 127 SQDSGELYSIWANGSTENQSQVTAVTSLGRMLTESIYT--DITINASDG-SIGAHRAVLA 183

Query: 318 ACSPYFLALFTTTLHSREQSDV 383
           A SP F ++F   L  +E S++
Sbjct: 184 ARSPVFRSMFLHDLKEKELSEI 205


>At5g19330.1 68418.m02303 armadillo/beta-catenin repeat family
           protein / BTB/POZ domain-containing protein contains
           armadillo/beta-catenin-like repeats, Pfam:PF00514 and a
           BTB/POZ domain, Pfam:PF00651
          Length = 710

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 18/72 (25%), Positives = 30/72 (41%)
 Frame = +3

Query: 279 DGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLISGVRSXXXXXXXXXXXXXXIDVT 458
           +G +F  HR  L A S  F A+F      ++  D+ I  ++               +D+T
Sbjct: 548 EGRTFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIKWEVFELMMRFIYTGSVDIT 607

Query: 459 DTNVHELLMTAD 494
           +    +LL  AD
Sbjct: 608 NEISKDLLRAAD 619


>At1g21780.1 68414.m02726 BTB/POZ domain-containing protein Contains
           similarity to gb|AJ000644 SPOP (speckle-type POZ
           protein) from Homo sapiens and contains a PF|00651
           BTB/POZ domain. ESTs gb|T75841, gb|R89974, gb|R30221,
           gb|N96386, gb|T76457, gb|AI100013 and gb|T76456 come
           from this gene;supported by full-length
          Length = 326

 Score = 31.1 bits (67), Expect = 1.0
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = +3

Query: 258 DAIVRADDGASFPVHRAILSACSPYFLALFTTTLHSREQSDVLI 389
           D I+   DG +   H+AILSA S  F ++F   L  +E S + I
Sbjct: 162 DVIIHTADG-TLSAHKAILSASSTVFKSMFHHDLMEKESSTIHI 204


>At2g40450.1 68415.m04992 speckle-type POZ protein-related contains
           Pfam PF00651 : BTB/POZ domain
          Length = 209

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 20/57 (35%), Positives = 28/57 (49%)
 Frame = +2

Query: 506 PGVLQLCCDHLRSSLNPKNCLGIMTFARRVFCYKLEADARRYLLRYFVTVATQSDEF 676
           P +  LC + L SSLN  N L I+  A+  F   L   A   ++    T+A+  DEF
Sbjct: 118 PHLRDLCRNELISSLNSSNALSILELAQIPFDKALNDPAFTTIITNISTIAS-GDEF 173


>At4g08455.1 68417.m01394 BTB/POZ domain-containing protein Interpro
           IPR000210/ PS50097: BTBB/POZ domain; similar to POZ 56
           protein (GI:17483747) [Mus musculus]
          Length = 243

 Score = 29.1 bits (62), Expect = 4.1
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 2/63 (3%)
 Frame = +3

Query: 216 DAGAPSTARVSSACDAIVRADDGAS--FPVHRAILSACSPYFLALFTTTLHSREQSDVLI 389
           D G  ST+R  +    I   D+  S   P H+++L + SP F A+    +       + I
Sbjct: 53  DHGTSSTSRSFTDVVLIASEDNAGSPPIPAHKSVLVSRSPVFKAMLENEMEESLSGTIKI 112

Query: 390 SGV 398
           S V
Sbjct: 113 SDV 115


>At1g03140.1 68414.m00291 splicing factor Prp18 family protein
           contains Pfam profile: PF02840 Prp18 domain
          Length = 420

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 21/52 (40%), Positives = 23/52 (44%)
 Frame = +3

Query: 132 LNAQRNGKRPK*QSDGGSGNRSVHVGGSDAGAPSTARVSSACDAIVRADDGA 287
           L AQR   R    + GG G  S    GS   A S +  SSA DA   AD  A
Sbjct: 48  LKAQR---RAAAAASGGDGKSSGSAPGSSNAATSASSKSSASDAAAIADSKA 96


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,352,718
Number of Sequences: 28952
Number of extensions: 384662
Number of successful extensions: 1051
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1014
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1051
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2058178400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -