SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30151.Seq
         (892 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g68870.1 68414.m07879 hypothetical protein                          30   1.8  
At5g37950.1 68418.m04571 hypothetical protein                          29   5.5  
At4g24680.1 68417.m03533 expressed protein                             28   7.2  

>At1g68870.1 68414.m07879 hypothetical protein
          Length = 147

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +3

Query: 474 SSWLTTHSTPATSHSLAIPXGVSETSLGGQTKGRARTRYTTIGK 605
           SSW +TH  P ++ + A     +   +  QT+ R R R++  G+
Sbjct: 82  SSWPSTHQPPRSTKNHAAAKNSNAKQVNNQTENRVRDRFSDEGE 125


>At5g37950.1 68418.m04571 hypothetical protein
          Length = 351

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +2

Query: 272 PHAPPPVSVKTTGPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRY 439
           P + P   +KT GP+W I ++ K   +  K         +QE   +  VIYD F Y
Sbjct: 40  PESLPASDLKTLGPIWFIIKLNKECEISFKKCLGQFLLQQQEE--IACVIYDEFMY 93


>At4g24680.1 68417.m03533 expressed protein
          Length = 1480

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +1

Query: 529 LMELARRRWEARPKAEQERATQLLGKAL 612
           + ELAR+R + R K E+ERA     KAL
Sbjct: 742 MRELARQRAQQRQKEEEERARDQRAKAL 769


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,247,979
Number of Sequences: 28952
Number of extensions: 349556
Number of successful extensions: 811
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 788
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 810
length of database: 12,070,560
effective HSP length: 81
effective length of database: 9,725,448
effective search space used: 2090971320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -