SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30149.Seq
         (867 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At2g37400.1 68415.m04586 chloroplast lumen common family protein...    31   1.3  
At5g37950.1 68418.m04571 hypothetical protein                          29   5.3  
At2g19710.1 68415.m02303 expressed protein   contains Pfam profi...    28   9.3  

>At2g37400.1 68415.m04586 chloroplast lumen common family protein
           very similar to GI:6729507 (At5g02590) and GI:7413648
           (At3g53560) [Arabidopsis thaliana]
          Length = 333

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = -1

Query: 837 FLPSNAIFLALKRVNPNPXIMAXNGHTLIMRSLTQCGGNRSDNE 706
           F  + A+FL   ++ P+P I A    T +M SL Q  GN S  E
Sbjct: 71  FTAAAALFLVNLQLKPSPAIAAPVAATPLMESLKQSNGNVSFEE 114


>At5g37950.1 68418.m04571 hypothetical protein
          Length = 351

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +2

Query: 272 PHAPPPVSVKTTGPVWDIGQVLKAARLLCKPPQQVDFEDEQEMRFVYSVIYDVFRY 439
           P + P   +KT GP+W I ++ K   +  K         +QE   +  VIYD F Y
Sbjct: 40  PESLPASDLKTLGPIWFIIKLNKECEISFKKCLGQFLLQQQEE--IACVIYDEFMY 93


>At2g19710.1 68415.m02303 expressed protein   contains Pfam profile:
           PF03398 eukaryotic protein of unknown function, DUF292
          Length = 937

 Score = 27.9 bits (59), Expect = 9.3
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +2

Query: 542 RDVAGRPDQGQSKNALHNYWKALDNHLRKW 631
           R    RPD+G+ +N  H Y  +   + +KW
Sbjct: 274 RPSRSRPDEGECRNPNHGYENSSSRNKQKW 303


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,908,364
Number of Sequences: 28952
Number of extensions: 366791
Number of successful extensions: 940
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 915
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 939
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 2028915200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -