SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30148.Seq
         (812 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g16860.1 68416.m02156 phytochelatin synthetase-related contai...    30   2.1  
At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zi...    29   3.7  
At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zi...    29   3.7  
At1g10490.1 68414.m01181 expressed protein contains Pfam profile...    29   4.9  
At4g16120.1 68417.m02443 phytochelatin synthetase-related contai...    28   6.4  
At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR...    28   6.4  
At2g36420.1 68415.m04471 expressed protein                             28   8.5  

>At3g16860.1 68416.m02156 phytochelatin synthetase-related contains
           Pfam PF04833: Phytochelatin synthetase-like conserved
           region
          Length = 653

 Score = 29.9 bits (64), Expect = 2.1
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%)
 Frame = -2

Query: 622 RCCLRFSCYFGSS-CHSGACVCRGCS 548
           +CC+ FS YF  S      C C GCS
Sbjct: 411 KCCVSFSSYFNDSVIPCKTCACGGCS 436


>At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zinc
           finger domain-containing protein contains Pfam domains
           PF03469: XH domain, PF03468: XS domain and PF03470: XS
           zinc finger domain
          Length = 647

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +3

Query: 210 DSESSGSAGCQRRPEQIFSKRNIDPEQIKEINNYYDIETTVTVEFD 347
           D  S+G +G + R E I   R  +P +++ + NY     T  VEF+
Sbjct: 145 DGRSAGESGSKLRDEYIL--RGFNPTRVRPLWNYLGHSGTAIVEFN 188


>At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zinc
           finger domain-containing protein contains Pfam domains
           PF03469: XH domain, PF03468: XS domain and PF03470: XS
           zinc finger domain
          Length = 647

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +3

Query: 210 DSESSGSAGCQRRPEQIFSKRNIDPEQIKEINNYYDIETTVTVEFD 347
           D  S+G +G + R E I   R  +P +++ + NY     T  VEF+
Sbjct: 145 DGRSAGESGSKLRDEYIL--RGFNPTRVRPLWNYLGHSGTAIVEFN 188


>At1g10490.1 68414.m01181 expressed protein contains Pfam profile
           PF05127: Putative ATPase (DUF699)
          Length = 1028

 Score = 28.7 bits (61), Expect = 4.9
 Identities = 16/46 (34%), Positives = 28/46 (60%)
 Frame = +1

Query: 145 PVTSTISEGLTKAKSYNDNDLRTLNPREVRDVKDALNRYFRRGTLI 282
           P++S I + +TK  +  D++  +   R+++ +KDALN  F  G LI
Sbjct: 207 PLSSHI-KSITKVPTKEDSEALSEAERDLKSLKDALNDDFPVGPLI 251


>At4g16120.1 68417.m02443 phytochelatin synthetase-related contains
           Pfam PF04833: Phytochelatin synthetase-like conserved
           region; supporting cDNA gi|26449620|dbj|AK117261.1|
          Length = 661

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 12/24 (50%), Positives = 14/24 (58%), Gaps = 3/24 (12%)
 Frame = -2

Query: 622 RCCLRFSCYFGSS---CHSGACVC 560
           RCC+ FS YF  S   C + AC C
Sbjct: 420 RCCVSFSAYFNDSIVPCKTCACGC 443


>At1g27170.1 68414.m03310 disease resistance protein (TIR-NBS-LRR
           class), putative domain signature TIR-NBS-LRR exists,
           suggestive of a disease resistance protein.
          Length = 1544

 Score = 28.3 bits (60), Expect = 6.4
 Identities = 21/79 (26%), Positives = 31/79 (39%)
 Frame = -3

Query: 417 PLFDLRFCF*SKVRQQSLCMLVPYQIPL*QWSRCRNNCLSP*FAPDQCSSSKISVQGVFD 238
           P+  LR    + V  +    L+P ++   QW  C    L P F   Q S   +S  G+  
Sbjct: 760 PMTKLRLLQINNVELEGNLKLLPSELKWIQWKGCPLENLPPDFLARQLSVLDLSESGIRQ 819

Query: 237 IPHFPRIQSPEVIVVVALR 181
           +         E + VV LR
Sbjct: 820 VQTLRNKMVDENLKVVILR 838


>At2g36420.1 68415.m04471 expressed protein 
          Length = 439

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 12/30 (40%), Positives = 15/30 (50%)
 Frame = -3

Query: 501 PVENTAEDPGHHKHSAQWSPENGSVCSFPL 412
           P+E   ED  HH+H     P N   CSF +
Sbjct: 258 PLEEEEEDEDHHQHEP--DPPNNLSCSFEI 285


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,635,007
Number of Sequences: 28952
Number of extensions: 294971
Number of successful extensions: 773
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 756
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 773
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1853336000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -